Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2359524..2360206 | Replicon | plasmid pCC1099_1 |
| Accession | NZ_CP121642 | ||
| Organism | Rhizobium sp. CC1099 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA644_RS32630 | Protein ID | WP_283073142.1 |
| Coordinates | 2359524..2359955 (-) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A559TH78 |
| Locus tag | QA644_RS32635 | Protein ID | WP_028739329.1 |
| Coordinates | 2359952..2360206 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA644_RS32610 (QA644_32610) | 2355365..2356381 | - | 1017 | WP_283073140.1 | TRAP transporter substrate-binding protein | - |
| QA644_RS32615 (QA644_32615) | 2356459..2357739 | - | 1281 | WP_239602616.1 | TRAP transporter large permease subunit | - |
| QA644_RS32620 (QA644_32620) | 2357750..2358310 | - | 561 | WP_283073141.1 | TRAP transporter small permease | - |
| QA644_RS32625 (QA644_32625) | 2358598..2359251 | + | 654 | WP_092588739.1 | TetR family transcriptional regulator | - |
| QA644_RS32630 (QA644_32630) | 2359524..2359955 | - | 432 | WP_283073142.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA644_RS32635 (QA644_32635) | 2359952..2360206 | - | 255 | WP_028739329.1 | plasmid stabilization protein | Antitoxin |
| QA644_RS32640 (QA644_32640) | 2360576..2360881 | - | 306 | Protein_2286 | transcriptional regulator | - |
| QA644_RS32645 (QA644_32645) | 2360984..2361810 | - | 827 | Protein_2287 | carbohydrate ABC transporter permease | - |
| QA644_RS32650 (QA644_32650) | 2361814..2362647 | - | 834 | WP_283074074.1 | sugar ABC transporter permease | - |
| QA644_RS32655 (QA644_32655) | 2362750..2364018 | - | 1269 | Protein_2289 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | katA / htpB | 1..2523472 | 2523472 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15572.10 Da Isoelectric Point: 7.0148
>T276479 WP_283073142.1 NZ_CP121642:c2359955-2359524 [Rhizobium sp. CC1099]
MILLDTNVISEPWKPVPDGAVIEWMDAQAIETLFLSAITIAELRFGIAAMPSGKRQIILRDRLEGEVLPHFAERILPFGL
ATSQFYSELMVRARVSGKAIGKADGYIAATAAANGLAVATRDTSPFEAAGVKVINPWSLQKRY
MILLDTNVISEPWKPVPDGAVIEWMDAQAIETLFLSAITIAELRFGIAAMPSGKRQIILRDRLEGEVLPHFAERILPFGL
ATSQFYSELMVRARVSGKAIGKADGYIAATAAANGLAVATRDTSPFEAAGVKVINPWSLQKRY
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|