Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2111659..2112449 | Replicon | plasmid pCC1099_1 |
| Accession | NZ_CP121642 | ||
| Organism | Rhizobium sp. CC1099 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | QA644_RS31430 | Protein ID | WP_283072986.1 |
| Coordinates | 2111659..2112156 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | - |
| Locus tag | QA644_RS31435 | Protein ID | WP_194730542.1 |
| Coordinates | 2112153..2112449 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA644_RS31400 (QA644_31400) | 2107320..2108027 | - | 708 | WP_283072982.1 | 5-oxoprolinase subunit PxpB | - |
| QA644_RS31405 (QA644_31405) | 2108024..2108452 | - | 429 | WP_194730546.1 | acetyl-CoA carboxylase | - |
| QA644_RS31410 (QA644_31410) | 2108449..2109840 | - | 1392 | WP_283072983.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| QA644_RS31415 (QA644_31415) | 2109840..2110283 | - | 444 | WP_283072984.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | - |
| QA644_RS31420 (QA644_31420) | 2110955..2111155 | + | 201 | WP_028739294.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QA644_RS31425 (QA644_31425) | 2111152..2111535 | + | 384 | WP_283072985.1 | type II toxin-antitoxin system VapC family toxin | - |
| QA644_RS31430 (QA644_31430) | 2111659..2112156 | - | 498 | WP_283072986.1 | GNAT family N-acetyltransferase | Toxin |
| QA644_RS31435 (QA644_31435) | 2112153..2112449 | - | 297 | WP_194730542.1 | DUF1778 domain-containing protein | Antitoxin |
| QA644_RS31440 (QA644_31440) | 2112895..2113308 | + | 414 | WP_283072987.1 | VOC family protein | - |
| QA644_RS31445 (QA644_31445) | 2113302..2114102 | - | 801 | WP_283072988.1 | IS21-like element ISSme2 family helper ATPase IstB | - |
| QA644_RS31450 (QA644_31450) | 2114102..2115388 | - | 1287 | WP_283072989.1 | IS21 family transposase | - |
| QA644_RS31455 (QA644_31455) | 2116207..2116791 | + | 585 | WP_283072990.1 | hypothetical protein | - |
| QA644_RS31460 (QA644_31460) | 2116842..2117054 | - | 213 | WP_194730540.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | katA / htpB | 1..2523472 | 2523472 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17750.44 Da Isoelectric Point: 8.0618
>T276478 WP_283072986.1 NZ_CP121642:c2112156-2111659 [Rhizobium sp. CC1099]
VTLSAPTPLADHHELAEFISGVVELDDWLRRRARANQAGGASRTFVVCEGNRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDRTFQGPGLGRALVRDAGLRLLNAAEILGIRGVLVHAISDDARAFYEAVGFLPSPSDPMMLMVGLRDLN
NALNP
VTLSAPTPLADHHELAEFISGVVELDDWLRRRARANQAGGASRTFVVCEGNRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDRTFQGPGLGRALVRDAGLRLLNAAEILGIRGVLVHAISDDARAFYEAVGFLPSPSDPMMLMVGLRDLN
NALNP
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|