Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 2110955..2111535 Replicon plasmid pCC1099_1
Accession NZ_CP121642
Organism Rhizobium sp. CC1099

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QA644_RS31425 Protein ID WP_283072985.1
Coordinates 2111152..2111535 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A559TGT7
Locus tag QA644_RS31420 Protein ID WP_028739294.1
Coordinates 2110955..2111155 (+) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA644_RS31395 (QA644_31395) 2106328..2107323 - 996 WP_283072981.1 biotin-dependent carboxyltransferase family protein -
QA644_RS31400 (QA644_31400) 2107320..2108027 - 708 WP_283072982.1 5-oxoprolinase subunit PxpB -
QA644_RS31405 (QA644_31405) 2108024..2108452 - 429 WP_194730546.1 acetyl-CoA carboxylase -
QA644_RS31410 (QA644_31410) 2108449..2109840 - 1392 WP_283072983.1 acetyl-CoA carboxylase biotin carboxylase subunit -
QA644_RS31415 (QA644_31415) 2109840..2110283 - 444 WP_283072984.1 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit -
QA644_RS31420 (QA644_31420) 2110955..2111155 + 201 WP_028739294.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QA644_RS31425 (QA644_31425) 2111152..2111535 + 384 WP_283072985.1 type II toxin-antitoxin system VapC family toxin Toxin
QA644_RS31430 (QA644_31430) 2111659..2112156 - 498 WP_283072986.1 GNAT family N-acetyltransferase -
QA644_RS31435 (QA644_31435) 2112153..2112449 - 297 WP_194730542.1 DUF1778 domain-containing protein -
QA644_RS31440 (QA644_31440) 2112895..2113308 + 414 WP_283072987.1 VOC family protein -
QA644_RS31445 (QA644_31445) 2113302..2114102 - 801 WP_283072988.1 IS21-like element ISSme2 family helper ATPase IstB -
QA644_RS31450 (QA644_31450) 2114102..2115388 - 1287 WP_283072989.1 IS21 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - katA / htpB 1..2523472 2523472


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13993.11 Da        Isoelectric Point: 6.8437

>T276477 WP_283072985.1 NZ_CP121642:2111152-2111535 [Rhizobium sp. CC1099]
VILADTSIWIHHFRHVDAELRRIIEDDRLLCDPTVIGELALGSLRDRGSVIAFLAAQRGAVVATHDEVMTMIDRHGIFSM
GIGYTDAHLLASVLVDQRAALWTRNKRLQGAAEKAGASLYIPVNLSH

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7108.21 Da        Isoelectric Point: 11.1107

>AT276477 WP_028739294.1 NZ_CP121642:2110955-2111155 [Rhizobium sp. CC1099]
MRSTINLDDTLLEKARSLTGTKETAALVRQALETLVRVESGKRLIALGGTMPDAEAAPRRRSTAAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A559TGT7

References