Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 703256..703830 | Replicon | chromosome |
| Accession | NZ_CP121641 | ||
| Organism | Rhizobium sp. CC1099 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA644_RS03450 | Protein ID | WP_283071085.1 |
| Coordinates | 703465..703830 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QA644_RS03445 | Protein ID | WP_194729179.1 |
| Coordinates | 703256..703471 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA644_RS03420 (QA644_03420) | 699469..700422 | - | 954 | WP_022716380.1 | sulfate adenylyltransferase subunit CysD | - |
| QA644_RS03425 (QA644_03425) | 700580..701320 | - | 741 | WP_074066964.1 | phosphoadenylyl-sulfate reductase | - |
| QA644_RS03430 (QA644_03430) | 701744..702190 | + | 447 | WP_022716377.1 | Rrf2 family transcriptional regulator | - |
| QA644_RS03435 (QA644_03435) | 702330..702716 | + | 387 | WP_028739821.1 | DUF6152 family protein | - |
| QA644_RS03440 (QA644_03440) | 702721..703197 | + | 477 | WP_074066966.1 | DUF2214 domain-containing protein | - |
| QA644_RS03445 (QA644_03445) | 703256..703471 | + | 216 | WP_194729179.1 | CopG family transcriptional regulator | Antitoxin |
| QA644_RS03450 (QA644_03450) | 703465..703830 | + | 366 | WP_283071085.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA644_RS03455 (QA644_03455) | 703890..704033 | + | 144 | WP_283071086.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QA644_RS03460 (QA644_03460) | 704252..705901 | - | 1650 | WP_239595110.1 | choline dehydrogenase | - |
| QA644_RS03465 (QA644_03465) | 705962..707425 | - | 1464 | WP_283071087.1 | betaine-aldehyde dehydrogenase | - |
| QA644_RS03470 (QA644_03470) | 707490..708074 | - | 585 | WP_283071088.1 | transcriptional regulator BetI | - |
| QA644_RS03475 (QA644_03475) | 708217..708771 | + | 555 | WP_283071089.1 | HdeD family acid-resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13637.63 Da Isoelectric Point: 6.2250
>T276474 WP_283071085.1 NZ_CP121641:703465-703830 [Rhizobium sp. CC1099]
MVKALFDTNILIDYLNAIPEARDELDRYGRRAISVVTWMEVLIGADPDVEAATRSFLNNFQIIAVDNVIAEGAVRLRQHH
RIKLPDAIIWSTADAHASLLVTRNTKDFPADNPGIRVPYLR
MVKALFDTNILIDYLNAIPEARDELDRYGRRAISVVTWMEVLIGADPDVEAATRSFLNNFQIIAVDNVIAEGAVRLRQHH
RIKLPDAIIWSTADAHASLLVTRNTKDFPADNPGIRVPYLR
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|