Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 428349..429019 Replicon plasmid pCC283b_2
Accession NZ_CP121637
Organism Rhizobium leguminosarum strain CC283b

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QA638_RS32160 Protein ID WP_018246604.1
Coordinates 428349..428753 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A444HGU5
Locus tag QA638_RS32165 Protein ID WP_018246605.1
Coordinates 428750..429019 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA638_RS32125 (QA638_32125) 423349..423870 + 522 WP_018246596.1 GNAT family N-acetyltransferase -
QA638_RS32130 (QA638_32130) 423892..424266 + 375 WP_018246597.1 type II toxin-antitoxin system RelE/ParE family toxin -
QA638_RS32135 (QA638_32135) 424281..424595 - 315 WP_011655201.1 helix-turn-helix transcriptional regulator -
QA638_RS32140 (QA638_32140) 425111..425848 + 738 WP_026188781.1 hypothetical protein -
QA638_RS32145 (QA638_32145) 425855..426016 - 162 WP_018246599.1 hypothetical protein -
QA638_RS32150 (QA638_32150) 426834..427394 - 561 WP_018246601.1 hypothetical protein -
QA638_RS32155 (QA638_32155) 427954..428295 + 342 WP_018246603.1 hypothetical protein -
QA638_RS32160 (QA638_32160) 428349..428753 - 405 WP_018246604.1 type II toxin-antitoxin system VapC family toxin Toxin
QA638_RS32165 (QA638_32165) 428750..429019 - 270 WP_018246605.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
QA638_RS32170 (QA638_32170) 429241..429459 - 219 WP_003547964.1 hypothetical protein -
QA638_RS32175 (QA638_32175) 429520..430365 - 846 WP_018517211.1 pirin family protein -
QA638_RS32180 (QA638_32180) 430461..432221 - 1761 WP_018246607.1 MOSC and FAD-binding oxidoreductase domain-containing protein -
QA638_RS32185 (QA638_32185) 432274..432807 - 534 WP_018246608.1 mismatch-specific DNA-glycosylase -
QA638_RS32190 (QA638_32190) 432950..433435 + 486 WP_026188782.1 DMT family transporter -
QA638_RS32195 (QA638_32195) 433432..433872 + 441 WP_018246610.1 DMT family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..596078 596078


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin

SpoVT-AbrB domain

(18-53)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14188.56 Da        Isoelectric Point: 5.1421

>T276473 WP_018246604.1 NZ_CP121637:c428753-428349 [Rhizobium leguminosarum]
VSRLYMLDTNIVSELARNPMGTITRRIAEVGPDAICVSIITASELRYGCAKKGSPKLLAQIEAILGSIPVLALDLPADAE
YGGIRAELEGAGKPTGPNDLFIAAHASALGAVLVTANMGEFMRIRALQVENWLI

Download         Length: 405 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10200.61 Da        Isoelectric Point: 4.5610

>AT276473 WP_018246605.1 NZ_CP121637:c429019-428750 [Rhizobium leguminosarum]
VVNSRRQEPIPQREAKLFRNNKSQAVRIPADFELPGDRVMIHRDGDRLIIEPVHRKNLLEVLAGLEPLGPEDQFPDVDDT
LLPVEEIDL

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A444HGU5

References