Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 121074..121846 | Replicon | plasmid pCC283b_2 |
| Accession | NZ_CP121637 | ||
| Organism | Rhizobium leguminosarum strain CC283b | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2Z4YVU8 |
| Locus tag | QA638_RS30715 | Protein ID | WP_018246328.1 |
| Coordinates | 121358..121846 (+) | Length | 163 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | A0A7Y3WKI8 |
| Locus tag | QA638_RS30710 | Protein ID | WP_026188748.1 |
| Coordinates | 121074..121358 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA638_RS30695 (QA638_30695) | 116268..118676 | + | 2409 | WP_018246324.1 | ABC transporter permease | - |
| QA638_RS30700 (QA638_30700) | 118666..119733 | + | 1068 | WP_018246325.1 | lipocalin-like domain-containing protein | - |
| QA638_RS30705 (QA638_30705) | 119841..120590 | + | 750 | WP_018246326.1 | sulfite exporter TauE/SafE family protein | - |
| QA638_RS30710 (QA638_30710) | 121074..121358 | + | 285 | WP_026188748.1 | DUF1778 domain-containing protein | Antitoxin |
| QA638_RS30715 (QA638_30715) | 121358..121846 | + | 489 | WP_018246328.1 | GNAT family N-acetyltransferase | Toxin |
| QA638_RS30720 (QA638_30720) | 122142..122354 | - | 213 | WP_245268285.1 | hypothetical protein | - |
| QA638_RS30725 (QA638_30725) | 122421..122660 | + | 240 | WP_245268286.1 | hypothetical protein | - |
| QA638_RS30730 (QA638_30730) | 122691..122951 | - | 261 | WP_018246330.1 | DUF982 domain-containing protein | - |
| QA638_RS30735 (QA638_30735) | 123605..123868 | + | 264 | WP_018246331.1 | DUF982 domain-containing protein | - |
| QA638_RS30740 (QA638_30740) | 124162..124488 | + | 327 | WP_155256937.1 | hypothetical protein | - |
| QA638_RS30745 (QA638_30745) | 124525..124737 | - | 213 | WP_018246334.1 | hypothetical protein | - |
| QA638_RS30750 (QA638_30750) | 125162..125380 | + | 219 | WP_128409058.1 | hypothetical protein | - |
| QA638_RS30755 (QA638_30755) | 125373..126074 | + | 702 | WP_018246336.1 | DUF899 family protein | - |
| QA638_RS30760 (QA638_30760) | 126094..126723 | - | 630 | WP_026188749.1 | J domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..596078 | 596078 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 17293.88 Da Isoelectric Point: 7.9271
>T276472 WP_018246328.1 NZ_CP121637:121358-121846 [Rhizobium leguminosarum]
MLSAPTLLGEAHDLQLFDSGHDSLDEWLRRRARANQVSGASRTYVVCEGERVVGYYCLSSGALAVSDAPGAIRRNMPDPV
PMAVLGRLAIDRNWQGKGIGAALLQDAVLRTGQAAHIMGIRGLLVHAISDEAKAFYEHFGFAASPANPMALVLSLKAQVG
LK
MLSAPTLLGEAHDLQLFDSGHDSLDEWLRRRARANQVSGASRTYVVCEGERVVGYYCLSSGALAVSDAPGAIRRNMPDPV
PMAVLGRLAIDRNWQGKGIGAALLQDAVLRTGQAAHIMGIRGLLVHAISDEAKAFYEHFGFAASPANPMALVLSLKAQVG
LK
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z4YVU8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Y3WKI8 |