Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 621398..621978 Replicon plasmid pCC283b_1
Accession NZ_CP121636
Organism Rhizobium leguminosarum strain CC283b

Toxin (Protein)


Gene name vapC Uniprot ID A0A444I7Z5
Locus tag QA638_RS27710 Protein ID WP_018245324.1
Coordinates 621398..621781 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A7Y3WNA0
Locus tag QA638_RS27715 Protein ID WP_018245323.1
Coordinates 621778..621978 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA638_RS27670 (QA638_27670) 616846..617108 - 263 Protein_594 Gfo/Idh/MocA family oxidoreductase -
QA638_RS27675 (QA638_27675) 617125..617328 - 204 Protein_595 hypothetical protein -
QA638_RS27680 (QA638_27680) 617482..618576 + 1095 WP_018245327.1 GSU2403 family nucleotidyltransferase fold protein -
QA638_RS27685 (QA638_27685) 618873..619925 - 1053 WP_018245326.1 ribosome small subunit-dependent GTPase A -
QA638_RS27690 (QA638_27690) 619960..620136 - 177 WP_018071841.1 hypothetical protein -
QA638_RS27695 (QA638_27695) 620313..620642 + 330 WP_018517229.1 hypothetical protein -
QA638_RS27700 (QA638_27700) 620641..620964 - 324 Protein_600 VapC toxin family PIN domain ribonuclease -
QA638_RS27705 (QA638_27705) 620961..621188 - 228 WP_085990123.1 CopG family transcriptional regulator -
QA638_RS27710 (QA638_27710) 621398..621781 - 384 WP_018245324.1 type II toxin-antitoxin system VapC family toxin Toxin
QA638_RS27715 (QA638_27715) 621778..621978 - 201 WP_018245323.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QA638_RS27720 (QA638_27720) 622198..622323 + 126 Protein_604 deaminase -
QA638_RS27725 (QA638_27725) 622482..622832 + 351 WP_080646143.1 hypothetical protein -
QA638_RS27730 (QA638_27730) 622981..623112 - 132 Protein_606 transposase domain-containing protein -
QA638_RS27735 (QA638_27735) 623172..623804 + 633 WP_018245319.1 DUF433 domain-containing protein -
QA638_RS27740 (QA638_27740) 623801..624175 + 375 WP_018245318.1 DUF5615 family PIN-like protein -
QA638_RS27745 (QA638_27745) 624247..625827 - 1581 WP_018245317.1 ABC transporter substrate-binding protein -
QA638_RS27750 (QA638_27750) 625949..626734 + 786 WP_018245316.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..1157213 1157213


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14117.31 Da        Isoelectric Point: 9.1808

>T276471 WP_018245324.1 NZ_CP121636:c621781-621398 [Rhizobium leguminosarum]
VILADTSIWIDHFRHVDAELRTIIEDDRLLCHPAVVGELALGSLRDRGRVIAFLAAQRQAFVATHDEVMTMIDRHGIFSM
GIGYTDAHLLASILLDRRAALWTRDKRLQAAAKKAGASLHKPANARN

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7124.23 Da        Isoelectric Point: 11.3760

>AT276471 WP_018245323.1 NZ_CP121636:c621978-621778 [Rhizobium leguminosarum]
MRSTINLDDTLMERARSLTGTKETAAIVRQALETLVRVESGKRLIALGGTMPDAEAAPRRRSAAAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A444I7Z5

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y3WNA0

References