Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 621398..621978 | Replicon | plasmid pCC283b_1 |
| Accession | NZ_CP121636 | ||
| Organism | Rhizobium leguminosarum strain CC283b | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A444I7Z5 |
| Locus tag | QA638_RS27710 | Protein ID | WP_018245324.1 |
| Coordinates | 621398..621781 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A7Y3WNA0 |
| Locus tag | QA638_RS27715 | Protein ID | WP_018245323.1 |
| Coordinates | 621778..621978 (-) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA638_RS27670 (QA638_27670) | 616846..617108 | - | 263 | Protein_594 | Gfo/Idh/MocA family oxidoreductase | - |
| QA638_RS27675 (QA638_27675) | 617125..617328 | - | 204 | Protein_595 | hypothetical protein | - |
| QA638_RS27680 (QA638_27680) | 617482..618576 | + | 1095 | WP_018245327.1 | GSU2403 family nucleotidyltransferase fold protein | - |
| QA638_RS27685 (QA638_27685) | 618873..619925 | - | 1053 | WP_018245326.1 | ribosome small subunit-dependent GTPase A | - |
| QA638_RS27690 (QA638_27690) | 619960..620136 | - | 177 | WP_018071841.1 | hypothetical protein | - |
| QA638_RS27695 (QA638_27695) | 620313..620642 | + | 330 | WP_018517229.1 | hypothetical protein | - |
| QA638_RS27700 (QA638_27700) | 620641..620964 | - | 324 | Protein_600 | VapC toxin family PIN domain ribonuclease | - |
| QA638_RS27705 (QA638_27705) | 620961..621188 | - | 228 | WP_085990123.1 | CopG family transcriptional regulator | - |
| QA638_RS27710 (QA638_27710) | 621398..621781 | - | 384 | WP_018245324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA638_RS27715 (QA638_27715) | 621778..621978 | - | 201 | WP_018245323.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QA638_RS27720 (QA638_27720) | 622198..622323 | + | 126 | Protein_604 | deaminase | - |
| QA638_RS27725 (QA638_27725) | 622482..622832 | + | 351 | WP_080646143.1 | hypothetical protein | - |
| QA638_RS27730 (QA638_27730) | 622981..623112 | - | 132 | Protein_606 | transposase domain-containing protein | - |
| QA638_RS27735 (QA638_27735) | 623172..623804 | + | 633 | WP_018245319.1 | DUF433 domain-containing protein | - |
| QA638_RS27740 (QA638_27740) | 623801..624175 | + | 375 | WP_018245318.1 | DUF5615 family PIN-like protein | - |
| QA638_RS27745 (QA638_27745) | 624247..625827 | - | 1581 | WP_018245317.1 | ABC transporter substrate-binding protein | - |
| QA638_RS27750 (QA638_27750) | 625949..626734 | + | 786 | WP_018245316.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..1157213 | 1157213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14117.31 Da Isoelectric Point: 9.1808
>T276471 WP_018245324.1 NZ_CP121636:c621781-621398 [Rhizobium leguminosarum]
VILADTSIWIDHFRHVDAELRTIIEDDRLLCHPAVVGELALGSLRDRGRVIAFLAAQRQAFVATHDEVMTMIDRHGIFSM
GIGYTDAHLLASILLDRRAALWTRDKRLQAAAKKAGASLHKPANARN
VILADTSIWIDHFRHVDAELRTIIEDDRLLCHPAVVGELALGSLRDRGRVIAFLAAQRQAFVATHDEVMTMIDRHGIFSM
GIGYTDAHLLASILLDRRAALWTRDKRLQAAAKKAGASLHKPANARN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A444I7Z5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Y3WNA0 |