Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 309490..310106 | Replicon | plasmid pCC283b_1 |
| Accession | NZ_CP121636 | ||
| Organism | Rhizobium leguminosarum strain CC283b | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A444IHQ6 |
| Locus tag | QA638_RS26105 | Protein ID | WP_018245485.1 |
| Coordinates | 309490..309900 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QA638_RS26110 | Protein ID | WP_245268281.1 |
| Coordinates | 309897..310106 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA638_RS26090 (QA638_26090) | 305334..306155 | + | 822 | WP_018245488.1 | 3-methyl-2-oxobutanoate hydroxymethyltransferase | - |
| QA638_RS26095 (QA638_26095) | 306177..307091 | - | 915 | WP_018245487.1 | hydrogen peroxide-inducible genes activator | - |
| QA638_RS26100 (QA638_26100) | 307238..309424 | + | 2187 | WP_018245486.1 | catalase/peroxidase HPI | - |
| QA638_RS26105 (QA638_26105) | 309490..309900 | - | 411 | WP_018245485.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA638_RS26110 (QA638_26110) | 309897..310106 | - | 210 | WP_245268281.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QA638_RS26115 (QA638_26115) | 310287..310844 | - | 558 | WP_018245484.1 | DUF3299 domain-containing protein | - |
| QA638_RS26120 (QA638_26120) | 311054..311512 | - | 459 | WP_018245483.1 | SgcJ/EcaC family oxidoreductase | - |
| QA638_RS26125 (QA638_26125) | 311656..312831 | + | 1176 | WP_245268272.1 | sensor histidine kinase | - |
| QA638_RS26130 (QA638_26130) | 312828..313490 | + | 663 | WP_018245481.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..1157213 | 1157213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14867.09 Da Isoelectric Point: 6.2317
>T276470 WP_018245485.1 NZ_CP121636:c309900-309490 [Rhizobium leguminosarum]
VITHLIDTNALIALIGRKSEILLKRVIDSDERSIGLSTAVMHELYHGAYKSTKTSYNLETLRLFVADFSVVGFEQEDALA
AGEIRAALAAKGTPIGPYDVLIAAQARTRDLVLVTNNVGVFRRVDGLLVEDWTVGR
VITHLIDTNALIALIGRKSEILLKRVIDSDERSIGLSTAVMHELYHGAYKSTKTSYNLETLRLFVADFSVVGFEQEDALA
AGEIRAALAAKGTPIGPYDVLIAAQARTRDLVLVTNNVGVFRRVDGLLVEDWTVGR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|