Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 167100..167902 | Replicon | plasmid pCC283b_1 |
Accession | NZ_CP121636 | ||
Organism | Rhizobium leguminosarum strain CC283b |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A444IGY5 |
Locus tag | QA638_RS25475 | Protein ID | WP_018245608.1 |
Coordinates | 167100..167627 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A7Y3SJF5 |
Locus tag | QA638_RS25480 | Protein ID | WP_018245607.1 |
Coordinates | 167624..167902 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA638_RS25460 (QA638_25460) | 162398..163522 | - | 1125 | WP_018245611.1 | DNA repair exonuclease | - |
QA638_RS25465 (QA638_25465) | 163812..165203 | - | 1392 | WP_026188694.1 | aldehyde dehydrogenase family protein | - |
QA638_RS25470 (QA638_25470) | 165205..166851 | - | 1647 | WP_018245609.1 | acetolactate synthase large subunit | - |
QA638_RS25475 (QA638_25475) | 167100..167627 | - | 528 | WP_018245608.1 | GNAT family N-acetyltransferase | Toxin |
QA638_RS25480 (QA638_25480) | 167624..167902 | - | 279 | WP_018245607.1 | DUF1778 domain-containing protein | Antitoxin |
QA638_RS25485 (QA638_25485) | 168057..168935 | - | 879 | WP_026188693.1 | DUF6030 family protein | - |
QA638_RS25490 (QA638_25490) | 169259..171373 | - | 2115 | WP_018245605.1 | carboxy terminal-processing peptidase | - |
QA638_RS25495 (QA638_25495) | 171521..172000 | - | 480 | WP_020493431.1 | MEKHLA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..1157213 | 1157213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 18780.78 Da Isoelectric Point: 9.5510
>T276469 WP_018245608.1 NZ_CP121636:c167627-167100 [Rhizobium leguminosarum]
VTLPVWHEEPIAKSHDRASFDCGDAAMNEFIRRFARQSHEQNAAKTFCAIDKAHPDRILGFYTVAPSAVTHEAVPPKMTR
GLARHEVAGFKLARLATDIKVAGKGLGGQLIAAAALRCLRLASEGGGILLIIDAKSERAAHWYASYGAEPLQGKPLTLVM
PLATFAADLKAKGLL
VTLPVWHEEPIAKSHDRASFDCGDAAMNEFIRRFARQSHEQNAAKTFCAIDKAHPDRILGFYTVAPSAVTHEAVPPKMTR
GLARHEVAGFKLARLATDIKVAGKGLGGQLIAAAALRCLRLASEGGGILLIIDAKSERAAHWYASYGAEPLQGKPLTLVM
PLATFAADLKAKGLL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444IGY5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Y3SJF5 |