Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-Phd
Location 47901..48592 Replicon plasmid pCC283b_1
Accession NZ_CP121636
Organism Rhizobium leguminosarum strain CC283b

Toxin (Protein)


Gene name vapC Uniprot ID A0A6P0D4X9
Locus tag QA638_RS24930 Protein ID WP_018245712.1
Coordinates 47901..48329 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A4R0AD13
Locus tag QA638_RS24935 Protein ID WP_017991284.1
Coordinates 48326..48592 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA638_RS24900 (QA638_24900) 42938..43741 - 804 WP_018245717.1 crotonase/enoyl-CoA hydratase family protein -
QA638_RS24905 (QA638_24905) 43830..44414 + 585 WP_026188704.1 TetR/AcrR family transcriptional regulator -
QA638_RS24910 (QA638_24910) 44687..45526 + 840 WP_018245715.1 transporter substrate-binding domain-containing protein -
QA638_RS24915 (QA638_24915) 45694..46356 + 663 WP_026188703.1 amino acid ABC transporter permease -
QA638_RS24920 (QA638_24920) 46363..47022 + 660 WP_011648868.1 amino acid ABC transporter permease -
QA638_RS24925 (QA638_24925) 47035..47805 + 771 WP_018245713.1 amino acid ABC transporter ATP-binding protein -
QA638_RS24930 (QA638_24930) 47901..48329 - 429 WP_018245712.1 type II toxin-antitoxin system VapC family toxin Toxin
QA638_RS24935 (QA638_24935) 48326..48592 - 267 WP_017991284.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QA638_RS24940 (QA638_24940) 48849..49598 + 750 WP_018245711.1 GntR family transcriptional regulator -
QA638_RS24945 (QA638_24945) 49602..50387 + 786 WP_018245710.1 transporter substrate-binding domain-containing protein -
QA638_RS24950 (QA638_24950) 50468..51139 + 672 WP_018245709.1 amino acid ABC transporter permease -
QA638_RS24955 (QA638_24955) 51136..51795 + 660 WP_018245708.1 amino acid ABC transporter permease -
QA638_RS24960 (QA638_24960) 51773..52498 + 726 WP_018245707.1 amino acid ABC transporter ATP-binding protein -
QA638_RS24965 (QA638_24965) 52647..53018 - 372 WP_018245706.1 type II toxin-antitoxin system RelE/ParE family toxin -
QA638_RS24970 (QA638_24970) 53018..53275 - 258 WP_018245705.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..1157213 1157213


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-66)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15914.18 Da        Isoelectric Point: 4.6772

>T276468 WP_018245712.1 NZ_CP121636:c48329-47901 [Rhizobium leguminosarum]
VRLLLDTNVLSEVTRPRPDAHVLQWLDSLDEDRSFISVVSIAEIRRGVALMESGRKRDALAEWLAQDLPQRFEQRVIPVD
QPVAIAWGDLMGLAKRSGRGLSSMDGLIAATAIAHDLTLATRNIKDFEGFEIELVDPWTERP

Download         Length: 429 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9960.34 Da        Isoelectric Point: 10.0842

>AT276468 WP_017991284.1 NZ_CP121636:c48592-48326 [Rhizobium leguminosarum]
MQPSRPEDKSWTVASAKAKLSEVIERAQATPQTIMRNGKPSVVVVSAEEWQRKTARKGTLAEFLMQSPLRGADLDLERQR
DEPRDLQL

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6P0D4X9

Antitoxin

Source ID Structure
AlphaFold DB A0A4R0AD13

References