Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 47901..48592 | Replicon | plasmid pCC283b_1 |
| Accession | NZ_CP121636 | ||
| Organism | Rhizobium leguminosarum strain CC283b | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A6P0D4X9 |
| Locus tag | QA638_RS24930 | Protein ID | WP_018245712.1 |
| Coordinates | 47901..48329 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A4R0AD13 |
| Locus tag | QA638_RS24935 | Protein ID | WP_017991284.1 |
| Coordinates | 48326..48592 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA638_RS24900 (QA638_24900) | 42938..43741 | - | 804 | WP_018245717.1 | crotonase/enoyl-CoA hydratase family protein | - |
| QA638_RS24905 (QA638_24905) | 43830..44414 | + | 585 | WP_026188704.1 | TetR/AcrR family transcriptional regulator | - |
| QA638_RS24910 (QA638_24910) | 44687..45526 | + | 840 | WP_018245715.1 | transporter substrate-binding domain-containing protein | - |
| QA638_RS24915 (QA638_24915) | 45694..46356 | + | 663 | WP_026188703.1 | amino acid ABC transporter permease | - |
| QA638_RS24920 (QA638_24920) | 46363..47022 | + | 660 | WP_011648868.1 | amino acid ABC transporter permease | - |
| QA638_RS24925 (QA638_24925) | 47035..47805 | + | 771 | WP_018245713.1 | amino acid ABC transporter ATP-binding protein | - |
| QA638_RS24930 (QA638_24930) | 47901..48329 | - | 429 | WP_018245712.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA638_RS24935 (QA638_24935) | 48326..48592 | - | 267 | WP_017991284.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QA638_RS24940 (QA638_24940) | 48849..49598 | + | 750 | WP_018245711.1 | GntR family transcriptional regulator | - |
| QA638_RS24945 (QA638_24945) | 49602..50387 | + | 786 | WP_018245710.1 | transporter substrate-binding domain-containing protein | - |
| QA638_RS24950 (QA638_24950) | 50468..51139 | + | 672 | WP_018245709.1 | amino acid ABC transporter permease | - |
| QA638_RS24955 (QA638_24955) | 51136..51795 | + | 660 | WP_018245708.1 | amino acid ABC transporter permease | - |
| QA638_RS24960 (QA638_24960) | 51773..52498 | + | 726 | WP_018245707.1 | amino acid ABC transporter ATP-binding protein | - |
| QA638_RS24965 (QA638_24965) | 52647..53018 | - | 372 | WP_018245706.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QA638_RS24970 (QA638_24970) | 53018..53275 | - | 258 | WP_018245705.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..1157213 | 1157213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15914.18 Da Isoelectric Point: 4.6772
>T276468 WP_018245712.1 NZ_CP121636:c48329-47901 [Rhizobium leguminosarum]
VRLLLDTNVLSEVTRPRPDAHVLQWLDSLDEDRSFISVVSIAEIRRGVALMESGRKRDALAEWLAQDLPQRFEQRVIPVD
QPVAIAWGDLMGLAKRSGRGLSSMDGLIAATAIAHDLTLATRNIKDFEGFEIELVDPWTERP
VRLLLDTNVLSEVTRPRPDAHVLQWLDSLDEDRSFISVVSIAEIRRGVALMESGRKRDALAEWLAQDLPQRFEQRVIPVD
QPVAIAWGDLMGLAKRSGRGLSSMDGLIAATAIAHDLTLATRNIKDFEGFEIELVDPWTERP
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P0D4X9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4R0AD13 |