Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-Phd |
Location | 7397565..7398265 | Replicon | chromosome |
Accession | NZ_CP121634 | ||
Organism | Bradyrhizobium sp. CIAT3101 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA645_RS34540 | Protein ID | WP_283045689.1 |
Coordinates | 7397840..7398265 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA645_RS34535 | Protein ID | WP_283045688.1 |
Coordinates | 7397565..7397843 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA645_RS34515 (QA645_34515) | 7392710..7393612 | - | 903 | WP_283045685.1 | sugar ABC transporter permease | - |
QA645_RS34520 (QA645_34520) | 7393612..7394697 | - | 1086 | WP_283045686.1 | ABC transporter ATP-binding protein | - |
QA645_RS34525 (QA645_34525) | 7394710..7395786 | - | 1077 | WP_254129261.1 | ABC transporter ATP-binding protein | - |
QA645_RS34530 (QA645_34530) | 7395783..7397333 | - | 1551 | WP_283045687.1 | glycerol-3-phosphate dehydrogenase | - |
QA645_RS34535 (QA645_34535) | 7397565..7397843 | + | 279 | WP_283045688.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QA645_RS34540 (QA645_34540) | 7397840..7398265 | + | 426 | WP_283045689.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QA645_RS34545 (QA645_34545) | 7398270..7399118 | - | 849 | WP_254129257.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QA645_RS34550 (QA645_34550) | 7399193..7399882 | - | 690 | WP_283045690.1 | HAD-IA family hydrolase | - |
QA645_RS34555 (QA645_34555) | 7400037..7400504 | + | 468 | WP_283045691.1 | nuclear transport factor 2 family protein | - |
QA645_RS34560 (QA645_34560) | 7400560..7400970 | + | 411 | WP_254196171.1 | nuclear transport factor 2 family protein | - |
QA645_RS34565 (QA645_34565) | 7401125..7401316 | - | 192 | WP_237866489.1 | hypothetical protein | - |
QA645_RS34570 (QA645_34570) | 7401539..7401949 | - | 411 | WP_283045692.1 | acyl-CoA thioesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15546.91 Da Isoelectric Point: 6.4708
>T276467 WP_283045689.1 NZ_CP121634:7397840-7398265 [Bradyrhizobium sp. CIAT3101]
VNLLLDTNVLSEVQRPVPSPKVLAWLDTVDEDRAFISVASIAELRRGVALLDDGRRRVALTAWLSHDLPARFAERILPID
HTVAERWGDLMAQSRRSGIALSVMDGFFAATALAQNLTLVTRNMKNFAAFGVPLLNPWDAA
VNLLLDTNVLSEVQRPVPSPKVLAWLDTVDEDRAFISVASIAELRRGVALLDDGRRRVALTAWLSHDLPARFAERILPID
HTVAERWGDLMAQSRRSGIALSVMDGFFAATALAQNLTLVTRNMKNFAAFGVPLLNPWDAA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|