Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4118110..4118737 | Replicon | chromosome |
Accession | NZ_CP121634 | ||
Organism | Bradyrhizobium sp. CIAT3101 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QA645_RS19430 | Protein ID | WP_283052314.1 |
Coordinates | 4118549..4118737 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QA645_RS19425 | Protein ID | WP_283052313.1 |
Coordinates | 4118110..4118502 (-) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA645_RS19400 (QA645_19400) | 4113534..4114313 | + | 780 | WP_283052304.1 | hypothetical protein | - |
QA645_RS19405 (QA645_19405) | 4114327..4115262 | - | 936 | WP_283052305.1 | integrase | - |
QA645_RS19410 (QA645_19410) | 4115408..4115659 | - | 252 | WP_283052307.1 | hypothetical protein | - |
QA645_RS19415 (QA645_19415) | 4115827..4116849 | - | 1023 | WP_283052309.1 | site-specific integrase | - |
QA645_RS19420 (QA645_19420) | 4116925..4117749 | - | 825 | WP_283052311.1 | hypothetical protein | - |
QA645_RS19425 (QA645_19425) | 4118110..4118502 | - | 393 | WP_283052313.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QA645_RS19430 (QA645_19430) | 4118549..4118737 | - | 189 | WP_283052314.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QA645_RS19435 (QA645_19435) | 4118991..4119683 | + | 693 | WP_283052316.1 | hypothetical protein | - |
QA645_RS19440 (QA645_19440) | 4119752..4120900 | + | 1149 | WP_283052318.1 | ImmA/IrrE family metallo-endopeptidase | - |
QA645_RS19445 (QA645_19445) | 4121391..4122179 | + | 789 | WP_283052320.1 | hypothetical protein | - |
QA645_RS19450 (QA645_19450) | 4122527..4122847 | + | 321 | WP_283052322.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4112158..4136472 | 24314 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6953.17 Da Isoelectric Point: 11.0319
>T276466 WP_283052314.1 NZ_CP121634:c4118737-4118549 [Bradyrhizobium sp. CIAT3101]
MKSADLIKALNADGWEQVAQKGSHIQFKHPTKKGRVTVPHPKRDIPIGTLKNIEKQANLKLK
MKSADLIKALNADGWEQVAQKGSHIQFKHPTKKGRVTVPHPKRDIPIGTLKNIEKQANLKLK
Download Length: 189 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13749.43 Da Isoelectric Point: 4.1687
>AT276466 WP_283052313.1 NZ_CP121634:c4118502-4118110 [Bradyrhizobium sp. CIAT3101]
MRYYIALIHKDADSDYGVSFPDLPGVITAGTDLDDARAMAAEALALHLEGMAADGEAVPEPSSLEEIMANTENRDGVAVL
IPAPAEDVKSVRVNITLPADVLSEIDHYAEQHGFTRSGFLAQAAKKAIAA
MRYYIALIHKDADSDYGVSFPDLPGVITAGTDLDDARAMAAEALALHLEGMAADGEAVPEPSSLEEIMANTENRDGVAVL
IPAPAEDVKSVRVNITLPADVLSEIDHYAEQHGFTRSGFLAQAAKKAIAA
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|