Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 8211..8799 | Replicon | plasmid pII_HAB11 |
| Accession | NZ_CP121633 | ||
| Organism | Acinetobacter baumannii strain HAB11 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
| Locus tag | MTT06_RS19155 | Protein ID | WP_000438826.1 |
| Coordinates | 8512..8799 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | MTT06_RS19150 | Protein ID | WP_001983304.1 |
| Coordinates | 8211..8525 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTT06_RS19130 (MTT06_19130) | 4038..4409 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTT06_RS19135 (MTT06_19135) | 4409..4582 | + | 174 | WP_001282484.1 | hypothetical protein | - |
| MTT06_RS19140 (MTT06_19140) | 4905..5366 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| MTT06_RS19145 (MTT06_19145) | 5671..8083 | - | 2413 | Protein_8 | TonB-dependent receptor ZnuD2 | - |
| MTT06_RS19150 (MTT06_19150) | 8211..8525 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| MTT06_RS19155 (MTT06_19155) | 8512..8799 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
| MTT06_RS19160 (MTT06_19160) | 9172..9690 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
| MTT06_RS19165 (MTT06_19165) | 9879..10022 | - | 144 | WP_001125246.1 | hypothetical protein | - |
| MTT06_RS19170 (MTT06_19170) | 10042..10617 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
| MTT06_RS19175 (MTT06_19175) | 10610..11560 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
| MTT06_RS19180 (MTT06_19180) | 12770..13141 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTT06_RS19185 (MTT06_19185) | 13141..13314 | + | 174 | WP_001282484.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..17462 | 17462 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276465 WP_000438826.1 NZ_CP121633:c8799-8512 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |