276464

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3944199..3944878 Replicon chromosome
Accession NZ_CP121632
Organism Acinetobacter baumannii strain HAB11

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag MTT06_RS19025 Protein ID WP_000838146.1
Coordinates 3944199..3944381 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag MTT06_RS19030 Protein ID WP_000966688.1
Coordinates 3944474..3944878 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTT06_RS18990 (MTT06_18990) 3939442..3939840 + 399 WP_283061245.1 phage tail terminator-like protein -
MTT06_RS18995 (MTT06_18995) 3939842..3940060 + 219 WP_001277696.1 hypothetical protein -
MTT06_RS19000 (MTT06_19000) 3940169..3940690 + 522 WP_000749909.1 SH3 domain-containing protein -
MTT06_RS19005 (MTT06_19005) 3940787..3941140 + 354 WP_000064593.1 hypothetical protein -
MTT06_RS19010 (MTT06_19010) 3941140..3942318 + 1179 WP_000002408.1 hypothetical protein -
MTT06_RS19015 (MTT06_19015) 3942371..3943288 + 918 WP_000094273.1 phage tail tube protein -
MTT06_RS19020 (MTT06_19020) 3943358..3943873 + 516 WP_001185592.1 hypothetical protein -
MTT06_RS19025 (MTT06_19025) 3944199..3944381 + 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
MTT06_RS19030 (MTT06_19030) 3944474..3944878 + 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
MTT06_RS19035 (MTT06_19035) 3944978..3945502 + 525 WP_000721574.1 DUF4468 domain-containing protein -
MTT06_RS19040 (MTT06_19040) 3945567..3945950 + 384 WP_000725052.1 hypothetical protein -
MTT06_RS19045 (MTT06_19045) 3946012..3946758 + 747 WP_000599537.1 hypothetical protein -
MTT06_RS19050 (MTT06_19050) 3946844..3947335 + 492 WP_000755583.1 DUF4468 domain-containing protein -
MTT06_RS19055 (MTT06_19055) 3947378..3947644 - 267 WP_000774879.1 hypothetical protein -
MTT06_RS19060 (MTT06_19060) 3947794..3948729 + 936 WP_000254125.1 ORF6N domain-containing protein -
MTT06_RS19065 (MTT06_19065) 3949070..3949585 + 516 WP_001056868.1 Rha family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T276464 WP_000838146.1 NZ_CP121632:3944199-3944381 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT276464 WP_000966688.1 NZ_CP121632:3944474-3944878 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References