Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1199676..1200355 Replicon chromosome
Accession NZ_CP121629
Organism Acinetobacter baumannii strain JAB270

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag MTS25_RS05670 Protein ID WP_000838146.1
Coordinates 1199676..1199858 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag MTS25_RS05675 Protein ID WP_000966688.1
Coordinates 1199951..1200355 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTS25_RS05630 (MTS25_05630) 1194827..1195231 + 405 WP_000247952.1 hypothetical protein -
MTS25_RS05635 (MTS25_05635) 1195203..1195571 + 369 WP_001993865.1 hypothetical protein -
MTS25_RS05640 (MTS25_05640) 1195573..1195971 + 399 WP_002062850.1 phage tail terminator-like protein -
MTS25_RS05645 (MTS25_05645) 1195973..1196191 + 219 WP_002002228.1 hypothetical protein -
MTS25_RS05650 (MTS25_05650) 1196287..1196640 + 354 WP_032051762.1 hypothetical protein -
MTS25_RS05655 (MTS25_05655) 1196640..1197795 + 1156 Protein_1089 phage tail protein -
MTS25_RS05660 (MTS25_05660) 1197848..1198765 + 918 WP_000094273.1 phage tail tube protein -
MTS25_RS05665 (MTS25_05665) 1198835..1199350 + 516 WP_001185592.1 hypothetical protein -
MTS25_RS05670 (MTS25_05670) 1199676..1199858 + 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
MTS25_RS05675 (MTS25_05675) 1199951..1200355 + 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
MTS25_RS05680 (MTS25_05680) 1200455..1200979 + 525 WP_000721574.1 DUF4468 domain-containing protein -
MTS25_RS05685 (MTS25_05685) 1201044..1201427 + 384 WP_000725052.1 hypothetical protein -
MTS25_RS05690 (MTS25_05690) 1201489..1202235 + 747 WP_000599537.1 hypothetical protein -
MTS25_RS05695 (MTS25_05695) 1202321..1202812 + 492 WP_000755583.1 DUF4468 domain-containing protein -
MTS25_RS05700 (MTS25_05700) 1202855..1203121 - 267 WP_000774879.1 hypothetical protein -
MTS25_RS05705 (MTS25_05705) 1203271..1204206 + 936 WP_000254125.1 ORF6N domain-containing protein -
MTS25_RS05710 (MTS25_05710) 1204547..1205062 + 516 WP_001056868.1 Rha family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1170079..1221655 51576


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T276461 WP_000838146.1 NZ_CP121629:1199676-1199858 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT276461 WP_000966688.1 NZ_CP121629:1199951-1200355 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References