Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1199676..1200355 | Replicon | chromosome |
| Accession | NZ_CP121629 | ||
| Organism | Acinetobacter baumannii strain JAB270 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS25_RS05670 | Protein ID | WP_000838146.1 |
| Coordinates | 1199676..1199858 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS25_RS05675 | Protein ID | WP_000966688.1 |
| Coordinates | 1199951..1200355 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS25_RS05630 (MTS25_05630) | 1194827..1195231 | + | 405 | WP_000247952.1 | hypothetical protein | - |
| MTS25_RS05635 (MTS25_05635) | 1195203..1195571 | + | 369 | WP_001993865.1 | hypothetical protein | - |
| MTS25_RS05640 (MTS25_05640) | 1195573..1195971 | + | 399 | WP_002062850.1 | phage tail terminator-like protein | - |
| MTS25_RS05645 (MTS25_05645) | 1195973..1196191 | + | 219 | WP_002002228.1 | hypothetical protein | - |
| MTS25_RS05650 (MTS25_05650) | 1196287..1196640 | + | 354 | WP_032051762.1 | hypothetical protein | - |
| MTS25_RS05655 (MTS25_05655) | 1196640..1197795 | + | 1156 | Protein_1089 | phage tail protein | - |
| MTS25_RS05660 (MTS25_05660) | 1197848..1198765 | + | 918 | WP_000094273.1 | phage tail tube protein | - |
| MTS25_RS05665 (MTS25_05665) | 1198835..1199350 | + | 516 | WP_001185592.1 | hypothetical protein | - |
| MTS25_RS05670 (MTS25_05670) | 1199676..1199858 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS25_RS05675 (MTS25_05675) | 1199951..1200355 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS25_RS05680 (MTS25_05680) | 1200455..1200979 | + | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| MTS25_RS05685 (MTS25_05685) | 1201044..1201427 | + | 384 | WP_000725052.1 | hypothetical protein | - |
| MTS25_RS05690 (MTS25_05690) | 1201489..1202235 | + | 747 | WP_000599537.1 | hypothetical protein | - |
| MTS25_RS05695 (MTS25_05695) | 1202321..1202812 | + | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| MTS25_RS05700 (MTS25_05700) | 1202855..1203121 | - | 267 | WP_000774879.1 | hypothetical protein | - |
| MTS25_RS05705 (MTS25_05705) | 1203271..1204206 | + | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| MTS25_RS05710 (MTS25_05710) | 1204547..1205062 | + | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1170079..1221655 | 51576 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276461 WP_000838146.1 NZ_CP121629:1199676-1199858 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276461 WP_000966688.1 NZ_CP121629:1199951-1200355 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|