Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 12135..12723 | Replicon | plasmid pII_JAB144 |
Accession | NZ_CP121628 | ||
Organism | Acinetobacter baumannii strain JAB144 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
Locus tag | MTS17_RS20465 | Protein ID | WP_000438826.1 |
Coordinates | 12135..12422 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | MTS17_RS20470 | Protein ID | WP_001983304.1 |
Coordinates | 12409..12723 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS17_RS20430 (MTS17_20430) | 7620..7793 | - | 174 | WP_001282484.1 | hypothetical protein | - |
MTS17_RS20435 (MTS17_20435) | 7793..8164 | - | 372 | WP_000504218.1 | hypothetical protein | - |
MTS17_RS20440 (MTS17_20440) | 8436..8690 | - | 255 | WP_001014303.1 | hypothetical protein | - |
MTS17_RS20445 (MTS17_20445) | 9374..10324 | + | 951 | WP_001205343.1 | replication initiation protein RepM | - |
MTS17_RS20450 (MTS17_20450) | 10317..10892 | + | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
MTS17_RS20455 (MTS17_20455) | 10912..11055 | + | 144 | WP_001125246.1 | hypothetical protein | - |
MTS17_RS20460 (MTS17_20460) | 11244..11762 | - | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
MTS17_RS20465 (MTS17_20465) | 12135..12422 | + | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
MTS17_RS20470 (MTS17_20470) | 12409..12723 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
MTS17_RS20475 (MTS17_20475) | 12851..15262 | + | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
MTS17_RS20480 (MTS17_20480) | 15567..16028 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
MTS17_RS20485 (MTS17_20485) | 16351..16524 | - | 174 | WP_001282484.1 | hypothetical protein | - |
MTS17_RS20490 (MTS17_20490) | 16524..16895 | - | 372 | WP_000504218.1 | hypothetical protein | - |
MTS17_RS20495 (MTS17_20495) | 17167..17421 | - | 255 | WP_001014303.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..17459 | 17459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276459 WP_000438826.1 NZ_CP121628:12135-12422 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |