Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5269..5948 | Replicon | chromosome |
| Accession | NZ_CP121625 | ||
| Organism | Acinetobacter baumannii strain JAB144 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS17_RS00050 | Protein ID | WP_000838146.1 |
| Coordinates | 5269..5451 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS17_RS00055 | Protein ID | WP_000966688.1 |
| Coordinates | 5544..5948 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS17_RS00015 (MTS17_00015) | 466..909 | + | 444 | WP_002016455.1 | phage tail terminator-like protein | - |
| MTS17_RS00020 (MTS17_00020) | 911..1129 | + | 219 | WP_001277696.1 | hypothetical protein | - |
| MTS17_RS00025 (MTS17_00025) | 1238..1759 | + | 522 | WP_000749909.1 | SH3 domain-containing protein | - |
| MTS17_RS00030 (MTS17_00030) | 1856..2209 | + | 354 | WP_000064593.1 | hypothetical protein | - |
| MTS17_RS00035 (MTS17_00035) | 2209..3387 | + | 1179 | WP_283059981.1 | phage tail protein | - |
| MTS17_RS00040 (MTS17_00040) | 3440..4357 | + | 918 | WP_000094253.1 | phage tail tube protein | - |
| MTS17_RS00045 (MTS17_00045) | 4428..4943 | + | 516 | WP_024616020.1 | hypothetical protein | - |
| MTS17_RS00050 (MTS17_00050) | 5269..5451 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS17_RS00055 (MTS17_00055) | 5544..5948 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS17_RS00060 (MTS17_00060) | 6048..6572 | + | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| MTS17_RS00065 (MTS17_00065) | 6637..7020 | + | 384 | WP_000725052.1 | hypothetical protein | - |
| MTS17_RS00070 (MTS17_00070) | 7082..7828 | + | 747 | WP_000599537.1 | hypothetical protein | - |
| MTS17_RS00075 (MTS17_00075) | 7914..8405 | + | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| MTS17_RS00080 (MTS17_00080) | 8448..8714 | - | 267 | WP_000774879.1 | hypothetical protein | - |
| MTS17_RS00085 (MTS17_00085) | 8864..9799 | + | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| MTS17_RS00090 (MTS17_00090) | 10140..10655 | + | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 141..25914 | 25773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276455 WP_000838146.1 NZ_CP121625:5269-5451 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276455 WP_000966688.1 NZ_CP121625:5544-5948 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|