Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 9538..10126 | Replicon | plasmid pII_JAB117 |
| Accession | NZ_CP121613 | ||
| Organism | Acinetobacter baumannii strain JAB117 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
| Locus tag | MTS71_RS19320 | Protein ID | WP_000438826.1 |
| Coordinates | 9839..10126 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | MTS71_RS19315 | Protein ID | WP_001983304.1 |
| Coordinates | 9538..9852 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS71_RS19295 (MTS71_19295) | 5366..5737 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS71_RS19300 (MTS71_19300) | 5737..5910 | + | 174 | WP_001282484.1 | hypothetical protein | - |
| MTS71_RS19305 (MTS71_19305) | 6233..6694 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| MTS71_RS19310 (MTS71_19310) | 6999..9410 | - | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
| MTS71_RS19315 (MTS71_19315) | 9538..9852 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| MTS71_RS19320 (MTS71_19320) | 9839..10126 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
| MTS71_RS19325 (MTS71_19325) | 10499..11017 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
| MTS71_RS19330 (MTS71_19330) | 11206..11349 | - | 144 | WP_001125246.1 | hypothetical protein | - |
| MTS71_RS19335 (MTS71_19335) | 11369..11944 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
| MTS71_RS19340 (MTS71_19340) | 11937..12887 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
| MTS71_RS19345 (MTS71_19345) | 14097..14468 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS71_RS19350 (MTS71_19350) | 14468..14641 | + | 174 | WP_001282484.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..17446 | 17446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276454 WP_000438826.1 NZ_CP121613:c10126-9839 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |