Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 787..1402 | Replicon | plasmid pII_JAB117 |
| Accession | NZ_CP121613 | ||
| Organism | Acinetobacter baumannii strain JAB117 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
| Locus tag | MTS71_RS19270 | Protein ID | WP_000438826.1 |
| Coordinates | 1115..1402 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | - |
| Locus tag | MTS71_RS19265 | Protein ID | WP_200165042.1 |
| Coordinates | 787..1128 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS71_RS19265 (MTS71_19265) | 787..1128 | - | 342 | WP_200165042.1 | BrnA antitoxin family protein | Antitoxin |
| MTS71_RS19270 (MTS71_19270) | 1115..1402 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
| MTS71_RS19275 (MTS71_19275) | 1774..2291 | + | 518 | Protein_3 | tetratricopeptide repeat protein | - |
| MTS71_RS19280 (MTS71_19280) | 2442..2621 | - | 180 | WP_151277549.1 | hypothetical protein | - |
| MTS71_RS19285 (MTS71_19285) | 2641..3214 | - | 574 | Protein_5 | plasmid replication DNA-binding protein | - |
| MTS71_RS19290 (MTS71_19290) | 3215..4156 | - | 942 | WP_060853654.1 | replication initiation protein RepM | - |
| MTS71_RS19295 (MTS71_19295) | 5366..5737 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS71_RS19300 (MTS71_19300) | 5737..5910 | + | 174 | WP_001282484.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..17446 | 17446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276453 WP_000438826.1 NZ_CP121613:c1402-1115 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|