Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 1428529..1429182 | Replicon | chromosome |
Accession | NZ_CP121612 | ||
Organism | Acinetobacter baumannii strain JAB117 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | MTS71_RS06825 | Protein ID | WP_000607077.1 |
Coordinates | 1428529..1428918 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | MTS71_RS06830 | Protein ID | WP_001288210.1 |
Coordinates | 1428925..1429182 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS71_RS06810 (MTS71_06810) | 1423647..1425842 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
MTS71_RS06815 (MTS71_06815) | 1426030..1426596 | - | 567 | WP_000651538.1 | rhombosortase | - |
MTS71_RS06820 (MTS71_06820) | 1426674..1427759 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
MTS71_RS06825 (MTS71_06825) | 1428529..1428918 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
MTS71_RS06830 (MTS71_06830) | 1428925..1429182 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
MTS71_RS06835 (MTS71_06835) | 1429370..1430542 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
MTS71_RS06840 (MTS71_06840) | 1430591..1432081 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
MTS71_RS06845 (MTS71_06845) | 1432263..1432640 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
MTS71_RS06850 (MTS71_06850) | 1432659..1433666 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276452 WP_000607077.1 NZ_CP121612:c1428918-1428529 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|