Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 674279..674958 | Replicon | chromosome |
| Accession | NZ_CP121612 | ||
| Organism | Acinetobacter baumannii strain JAB117 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS71_RS03285 | Protein ID | WP_000838146.1 |
| Coordinates | 674776..674958 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS71_RS03280 | Protein ID | WP_000966688.1 |
| Coordinates | 674279..674683 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS71_RS03245 (MTS71_03245) | 669572..670087 | - | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
| MTS71_RS03250 (MTS71_03250) | 670428..671363 | - | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| MTS71_RS03255 (MTS71_03255) | 671513..671779 | + | 267 | WP_000774879.1 | hypothetical protein | - |
| MTS71_RS03260 (MTS71_03260) | 671822..672313 | - | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| MTS71_RS03265 (MTS71_03265) | 672399..673145 | - | 747 | WP_000599537.1 | hypothetical protein | - |
| MTS71_RS03270 (MTS71_03270) | 673207..673590 | - | 384 | WP_000725052.1 | hypothetical protein | - |
| MTS71_RS03275 (MTS71_03275) | 673655..674179 | - | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| MTS71_RS03280 (MTS71_03280) | 674279..674683 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS71_RS03285 (MTS71_03285) | 674776..674958 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS71_RS03290 (MTS71_03290) | 675284..675799 | - | 516 | WP_024616020.1 | hypothetical protein | - |
| MTS71_RS03295 (MTS71_03295) | 675870..676787 | - | 918 | WP_000094253.1 | phage tail tube protein | - |
| MTS71_RS03300 (MTS71_03300) | 676840..678195 | - | 1356 | WP_000002415.1 | hypothetical protein | - |
| MTS71_RS03305 (MTS71_03305) | 678195..678548 | - | 354 | WP_000064593.1 | hypothetical protein | - |
| MTS71_RS03310 (MTS71_03310) | 678645..679166 | - | 522 | WP_000749909.1 | SH3 domain-containing protein | - |
| MTS71_RS03315 (MTS71_03315) | 679275..679493 | - | 219 | WP_001277696.1 | hypothetical protein | - |
| MTS71_RS03320 (MTS71_03320) | 679495..679938 | - | 444 | WP_002016455.1 | phage tail terminator-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 654313..708802 | 54489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276451 WP_000838146.1 NZ_CP121612:c674958-674776 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276451 WP_000966688.1 NZ_CP121612:c674683-674279 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|