Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 15473..16061 | Replicon | plasmid pIII_JAB186 |
Accession | NZ_CP121611 | ||
Organism | Acinetobacter baumannii strain JAB186 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
Locus tag | MTS34_RS20185 | Protein ID | WP_000438826.1 |
Coordinates | 15774..16061 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | MTS34_RS20180 | Protein ID | WP_001983304.1 |
Coordinates | 15473..15787 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS34_RS20155 (MTS34_20155) | 10986..11342 | + | 357 | WP_000269902.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MTS34_RS20160 (MTS34_20160) | 11335..11637 | + | 303 | WP_001140622.1 | XRE family transcriptional regulator | - |
MTS34_RS20165 (MTS34_20165) | 11630..11839 | + | 210 | WP_000069473.1 | hypothetical protein | - |
MTS34_RS20170 (MTS34_20170) | 12165..12626 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
MTS34_RS20175 (MTS34_20175) | 12931..15345 | - | 2415 | Protein_17 | TonB-dependent receptor ZnuD2 | - |
MTS34_RS20180 (MTS34_20180) | 15473..15787 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
MTS34_RS20185 (MTS34_20185) | 15774..16061 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
MTS34_RS20190 (MTS34_20190) | 16370..17197 | + | 828 | WP_000713530.1 | OXA-24 family carbapenem-hydrolyzing class D beta-lactamase OXA-72 | - |
MTS34_RS20195 (MTS34_20195) | 17455..17991 | - | 537 | WP_005249161.1 | plasmid replication DNA-binding protein | - |
MTS34_RS20200 (MTS34_20200) | 18059..18982 | - | 924 | WP_004282204.1 | replication initiation protein RepM | - |
MTS34_RS20205 (MTS34_20205) | 19508..20944 | - | 1437 | WP_039090895.1 | MobQ family relaxase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(E) / msr(E) / blaOXA-72 | - | 1..21454 | 21454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276450 WP_000438826.1 NZ_CP121611:c16061-15774 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |