Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2631934..2632613 | Replicon | chromosome |
| Accession | NZ_CP121609 | ||
| Organism | Acinetobacter baumannii strain JAB186 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS34_RS12710 | Protein ID | WP_000838146.1 |
| Coordinates | 2632431..2632613 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS34_RS12705 | Protein ID | WP_000966688.1 |
| Coordinates | 2631934..2632338 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS34_RS12695 (MTS34_12695) | 2630890..2631153 | - | 264 | WP_001275792.1 | hypothetical protein | - |
| MTS34_RS12700 (MTS34_12700) | 2631155..2631835 | - | 681 | WP_000721572.1 | hypothetical protein | - |
| MTS34_RS12705 (MTS34_12705) | 2631934..2632338 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS34_RS12710 (MTS34_12710) | 2632431..2632613 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS34_RS12715 (MTS34_12715) | 2632939..2633454 | - | 516 | WP_024616020.1 | hypothetical protein | - |
| MTS34_RS12720 (MTS34_12720) | 2633525..2634442 | - | 918 | WP_000094253.1 | phage tail tube protein | - |
| MTS34_RS12725 (MTS34_12725) | 2634495..2635850 | - | 1356 | WP_003249252.1 | hypothetical protein | - |
| MTS34_RS12730 (MTS34_12730) | 2635850..2636203 | - | 354 | WP_000064593.1 | hypothetical protein | - |
| MTS34_RS12735 (MTS34_12735) | 2636300..2636821 | - | 522 | WP_000749909.1 | SH3 domain-containing protein | - |
| MTS34_RS12740 (MTS34_12740) | 2636930..2637148 | - | 219 | WP_001277696.1 | hypothetical protein | - |
| MTS34_RS12745 (MTS34_12745) | 2637150..2637593 | - | 444 | WP_002016455.1 | phage tail terminator-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2616336..2665638 | 49302 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276446 WP_000838146.1 NZ_CP121609:c2632613-2632431 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276446 WP_000966688.1 NZ_CP121609:c2632338-2631934 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|