Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2584288..2584967 Replicon chromosome
Accession NZ_CP121598
Organism Acinetobacter baumannii strain JAB77

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag MTS78_RS12535 Protein ID WP_000838146.1
Coordinates 2584785..2584967 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag MTS78_RS12530 Protein ID WP_000966688.1
Coordinates 2584288..2584692 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTS78_RS12495 (MTS78_12495) 2579581..2580096 - 516 WP_001056868.1 Rha family transcriptional regulator -
MTS78_RS12500 (MTS78_12500) 2580437..2581372 - 936 WP_000254125.1 ORF6N domain-containing protein -
MTS78_RS12505 (MTS78_12505) 2581522..2581788 + 267 WP_000774879.1 hypothetical protein -
MTS78_RS12510 (MTS78_12510) 2581831..2582322 - 492 WP_000755583.1 DUF4468 domain-containing protein -
MTS78_RS12515 (MTS78_12515) 2582408..2583154 - 747 WP_000599537.1 hypothetical protein -
MTS78_RS12520 (MTS78_12520) 2583216..2583599 - 384 WP_000725052.1 hypothetical protein -
MTS78_RS12525 (MTS78_12525) 2583664..2584188 - 525 WP_000721574.1 DUF4468 domain-containing protein -
MTS78_RS12530 (MTS78_12530) 2584288..2584692 - 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
MTS78_RS12535 (MTS78_12535) 2584785..2584967 - 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
MTS78_RS12540 (MTS78_12540) 2585293..2585808 - 516 WP_001185592.1 hypothetical protein -
MTS78_RS12545 (MTS78_12545) 2585878..2586795 - 918 WP_000094273.1 phage tail tube protein -
MTS78_RS12550 (MTS78_12550) 2586848..2588003 - 1156 Protein_2462 phage tail protein -
MTS78_RS12555 (MTS78_12555) 2588003..2588356 - 354 WP_032051762.1 hypothetical protein -
MTS78_RS12560 (MTS78_12560) 2588452..2588670 - 219 WP_002002228.1 hypothetical protein -
MTS78_RS12565 (MTS78_12565) 2588672..2589070 - 399 WP_002062850.1 phage tail terminator-like protein -
MTS78_RS12570 (MTS78_12570) 2589072..2589440 - 369 WP_001993865.1 hypothetical protein -
MTS78_RS12575 (MTS78_12575) 2589412..2589816 - 405 WP_000247952.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2562988..2616235 53247


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T276443 WP_000838146.1 NZ_CP121598:c2584967-2584785 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT276443 WP_000966688.1 NZ_CP121598:c2584692-2584288 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References