Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2508495..2509174 | Replicon | chromosome |
| Accession | NZ_CP121595 | ||
| Organism | Acinetobacter baumannii strain MAB17 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS72_RS12045 | Protein ID | WP_000838146.1 |
| Coordinates | 2508992..2509174 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS72_RS12040 | Protein ID | WP_000966688.1 |
| Coordinates | 2508495..2508899 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS72_RS12005 (MTS72_12005) | 2503788..2504303 | - | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
| MTS72_RS12010 (MTS72_12010) | 2504644..2505579 | - | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| MTS72_RS12015 (MTS72_12015) | 2505729..2505995 | + | 267 | WP_000774879.1 | hypothetical protein | - |
| MTS72_RS12020 (MTS72_12020) | 2506038..2506529 | - | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| MTS72_RS12025 (MTS72_12025) | 2506615..2507361 | - | 747 | WP_000599537.1 | hypothetical protein | - |
| MTS72_RS12030 (MTS72_12030) | 2507423..2507806 | - | 384 | WP_000725052.1 | hypothetical protein | - |
| MTS72_RS12035 (MTS72_12035) | 2507871..2508395 | - | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| MTS72_RS12040 (MTS72_12040) | 2508495..2508899 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS72_RS12045 (MTS72_12045) | 2508992..2509174 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS72_RS12050 (MTS72_12050) | 2509500..2510015 | - | 516 | WP_024616020.1 | hypothetical protein | - |
| MTS72_RS12055 (MTS72_12055) | 2510086..2511003 | - | 918 | WP_283026454.1 | phage tail tube protein | - |
| MTS72_RS12060 (MTS72_12060) | 2511056..2512360 | - | 1305 | WP_283026455.1 | pyocin knob domain-containing protein | - |
| MTS72_RS12065 (MTS72_12065) | 2512360..2512713 | - | 354 | WP_283026456.1 | hypothetical protein | - |
| MTS72_RS12070 (MTS72_12070) | 2512809..2513027 | - | 219 | WP_031380852.1 | hypothetical protein | - |
| MTS72_RS12075 (MTS72_12075) | 2513029..2513427 | - | 399 | WP_001251837.1 | phage tail terminator-like protein | - |
| MTS72_RS12080 (MTS72_12080) | 2513429..2513797 | - | 369 | WP_031380853.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2488529..2542500 | 53971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276440 WP_000838146.1 NZ_CP121595:c2509174-2508992 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276440 WP_000966688.1 NZ_CP121595:c2508899-2508495 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|