Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1179616..1180295 Replicon chromosome
Accession NZ_CP121588
Organism Acinetobacter baumannii strain MAB9

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag MTS46_RS05590 Protein ID WP_000838146.1
Coordinates 1179616..1179798 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag MTS46_RS05595 Protein ID WP_000966688.1
Coordinates 1179891..1180295 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTS46_RS05550 (MTS46_05550) 1174767..1175171 + 405 WP_000247952.1 hypothetical protein -
MTS46_RS05555 (MTS46_05555) 1175143..1175511 + 369 WP_001993865.1 hypothetical protein -
MTS46_RS05560 (MTS46_05560) 1175513..1175911 + 399 WP_002062850.1 phage tail terminator-like protein -
MTS46_RS05565 (MTS46_05565) 1175913..1176131 + 219 WP_002002228.1 hypothetical protein -
MTS46_RS05570 (MTS46_05570) 1176227..1176580 + 354 WP_032051762.1 hypothetical protein -
MTS46_RS05575 (MTS46_05575) 1176580..1177735 + 1156 Protein_1073 phage tail protein -
MTS46_RS05580 (MTS46_05580) 1177788..1178705 + 918 WP_000094273.1 phage tail tube protein -
MTS46_RS05585 (MTS46_05585) 1178775..1179290 + 516 WP_001185592.1 hypothetical protein -
MTS46_RS05590 (MTS46_05590) 1179616..1179798 + 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
MTS46_RS05595 (MTS46_05595) 1179891..1180295 + 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
MTS46_RS05600 (MTS46_05600) 1180395..1180919 + 525 WP_000721574.1 DUF4468 domain-containing protein -
MTS46_RS05605 (MTS46_05605) 1180984..1181367 + 384 WP_000725052.1 hypothetical protein -
MTS46_RS05610 (MTS46_05610) 1181429..1182175 + 747 WP_000599537.1 hypothetical protein -
MTS46_RS05615 (MTS46_05615) 1182261..1182752 + 492 WP_000755583.1 DUF4468 domain-containing protein -
MTS46_RS05620 (MTS46_05620) 1182795..1183061 - 267 WP_000774879.1 hypothetical protein -
MTS46_RS05625 (MTS46_05625) 1183211..1184146 + 936 WP_000254125.1 ORF6N domain-containing protein -
MTS46_RS05630 (MTS46_05630) 1184487..1185002 + 516 WP_001056868.1 Rha family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1149728..1201595 51867


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T276438 WP_000838146.1 NZ_CP121588:1179616-1179798 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT276438 WP_000966688.1 NZ_CP121588:1179891-1180295 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References