Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 430201..430854 | Replicon | chromosome |
Accession | NZ_CP121588 | ||
Organism | Acinetobacter baumannii strain MAB9 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | MTS46_RS02110 | Protein ID | WP_000607077.1 |
Coordinates | 430465..430854 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | MTS46_RS02105 | Protein ID | WP_001288210.1 |
Coordinates | 430201..430458 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS46_RS02085 (MTS46_02085) | 425717..426724 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
MTS46_RS02090 (MTS46_02090) | 426743..427120 | + | 378 | WP_064894046.1 | 50S ribosomal protein L17 | - |
MTS46_RS02095 (MTS46_02095) | 427302..428792 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
MTS46_RS02100 (MTS46_02100) | 428841..430013 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
MTS46_RS02105 (MTS46_02105) | 430201..430458 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
MTS46_RS02110 (MTS46_02110) | 430465..430854 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
MTS46_RS02115 (MTS46_02115) | 431624..432709 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
MTS46_RS02120 (MTS46_02120) | 432787..433353 | + | 567 | WP_000651538.1 | rhombosortase | - |
MTS46_RS02125 (MTS46_02125) | 433541..435736 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276437 WP_000607077.1 NZ_CP121588:430465-430854 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|