276435

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1893255..1893934 Replicon chromosome
Accession NZ_CP121586
Organism Acinetobacter baumannii strain RAB11

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag MTS20_RS09050 Protein ID WP_000838146.1
Coordinates 1893255..1893437 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag MTS20_RS09055 Protein ID WP_000966688.1
Coordinates 1893530..1893934 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTS20_RS09010 (MTS20_09010) 1888383..1888787 + 405 WP_000247952.1 hypothetical protein -
MTS20_RS09015 (MTS20_09015) 1888759..1889127 + 369 WP_001993865.1 hypothetical protein -
MTS20_RS09020 (MTS20_09020) 1889129..1889527 + 399 WP_002062850.1 phage tail terminator-like protein -
MTS20_RS09025 (MTS20_09025) 1889529..1889747 + 219 WP_002002228.1 hypothetical protein -
MTS20_RS09030 (MTS20_09030) 1889843..1890196 + 354 WP_032051762.1 hypothetical protein -
MTS20_RS09035 (MTS20_09035) 1890196..1891374 + 1179 WP_283016356.1 phage tail protein -
MTS20_RS09040 (MTS20_09040) 1891427..1892344 + 918 WP_000094278.1 phage tail tube protein -
MTS20_RS09045 (MTS20_09045) 1892414..1892929 + 516 WP_162208568.1 hypothetical protein -
MTS20_RS09050 (MTS20_09050) 1893255..1893437 + 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
MTS20_RS09055 (MTS20_09055) 1893530..1893934 + 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
MTS20_RS09060 (MTS20_09060) 1894034..1894558 + 525 WP_000721574.1 DUF4468 domain-containing protein -
MTS20_RS09065 (MTS20_09065) 1894623..1895006 + 384 WP_000725052.1 hypothetical protein -
MTS20_RS09070 (MTS20_09070) 1895068..1895814 + 747 WP_000599537.1 hypothetical protein -
MTS20_RS09075 (MTS20_09075) 1895900..1896391 + 492 WP_000755583.1 DUF4468 domain-containing protein -
MTS20_RS09080 (MTS20_09080) 1896434..1896700 - 267 WP_000774879.1 hypothetical protein -
MTS20_RS09085 (MTS20_09085) 1896850..1897785 + 936 WP_000254125.1 ORF6N domain-containing protein -
MTS20_RS09090 (MTS20_09090) 1898126..1898641 + 516 WP_001056868.1 Rha family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1861762..1914624 52862


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T276435 WP_000838146.1 NZ_CP121586:1893255-1893437 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT276435 WP_000966688.1 NZ_CP121586:1893530-1893934 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References