Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 1144439..1145092 | Replicon | chromosome |
| Accession | NZ_CP121586 | ||
| Organism | Acinetobacter baumannii strain RAB11 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | MTS20_RS05530 | Protein ID | WP_000607077.1 |
| Coordinates | 1144703..1145092 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | MTS20_RS05525 | Protein ID | WP_001288210.1 |
| Coordinates | 1144439..1144696 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS20_RS05505 (MTS20_05505) | 1139955..1140962 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| MTS20_RS05510 (MTS20_05510) | 1140981..1141358 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| MTS20_RS05515 (MTS20_05515) | 1141540..1143030 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| MTS20_RS05520 (MTS20_05520) | 1143079..1144251 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| MTS20_RS05525 (MTS20_05525) | 1144439..1144696 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| MTS20_RS05530 (MTS20_05530) | 1144703..1145092 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
| MTS20_RS05535 (MTS20_05535) | 1145862..1146947 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| MTS20_RS05540 (MTS20_05540) | 1147025..1147591 | + | 567 | WP_000651538.1 | rhombosortase | - |
| MTS20_RS05545 (MTS20_05545) | 1147779..1149974 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276434 WP_000607077.1 NZ_CP121586:1144703-1145092 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|