Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 11690..12278 | Replicon | plasmid pII_RAB14 |
| Accession | NZ_CP121584 | ||
| Organism | Acinetobacter baumannii strain RAB14 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
| Locus tag | MTS22_RS18980 | Protein ID | WP_000438826.1 |
| Coordinates | 11991..12278 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | MTS22_RS18975 | Protein ID | WP_001983304.1 |
| Coordinates | 11690..12004 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS22_RS18955 (MTS22_18955) | 7518..7889 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS22_RS18960 (MTS22_18960) | 7889..8062 | + | 174 | WP_001282484.1 | hypothetical protein | - |
| MTS22_RS18965 (MTS22_18965) | 8385..8846 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| MTS22_RS18970 (MTS22_18970) | 9151..11562 | - | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
| MTS22_RS18975 (MTS22_18975) | 11690..12004 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| MTS22_RS18980 (MTS22_18980) | 11991..12278 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
| MTS22_RS18985 (MTS22_18985) | 12651..13169 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
| MTS22_RS18990 (MTS22_18990) | 13358..13501 | - | 144 | WP_001125246.1 | hypothetical protein | - |
| MTS22_RS18995 (MTS22_18995) | 13521..14096 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
| MTS22_RS19000 (MTS22_19000) | 14089..15039 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
| MTS22_RS19005 (MTS22_19005) | 16249..16620 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS22_RS19010 (MTS22_19010) | 16620..16793 | + | 174 | WP_001282484.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..17460 | 17460 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276433 WP_000438826.1 NZ_CP121584:c12278-11991 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |