Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 2959..3547 | Replicon | plasmid pII_RAB14 |
| Accession | NZ_CP121584 | ||
| Organism | Acinetobacter baumannii strain RAB14 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
| Locus tag | MTS22_RS18930 | Protein ID | WP_000438826.1 |
| Coordinates | 3260..3547 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | MTS22_RS18925 | Protein ID | WP_001983304.1 |
| Coordinates | 2959..3273 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS22_RS18920 (MTS22_18920) | 421..2831 | - | 2411 | Protein_1 | TonB-dependent receptor ZnuD2 | - |
| MTS22_RS18925 (MTS22_18925) | 2959..3273 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| MTS22_RS18930 (MTS22_18930) | 3260..3547 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
| MTS22_RS18935 (MTS22_18935) | 3920..4438 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
| MTS22_RS18940 (MTS22_18940) | 4627..4770 | - | 144 | WP_001125246.1 | hypothetical protein | - |
| MTS22_RS18945 (MTS22_18945) | 4790..5365 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
| MTS22_RS18950 (MTS22_18950) | 5358..6308 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
| MTS22_RS18955 (MTS22_18955) | 7518..7889 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS22_RS18960 (MTS22_18960) | 7889..8062 | + | 174 | WP_001282484.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..17460 | 17460 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276432 WP_000438826.1 NZ_CP121584:c3547-3260 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |