Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 708439..709118 | Replicon | chromosome |
| Accession | NZ_CP121583 | ||
| Organism | Acinetobacter baumannii strain RAB14 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS22_RS03280 | Protein ID | WP_000838146.1 |
| Coordinates | 708439..708621 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS22_RS03285 | Protein ID | WP_000966688.1 |
| Coordinates | 708714..709118 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS22_RS03245 (MTS22_03245) | 703737..704105 | + | 369 | WP_025468552.1 | hypothetical protein | - |
| MTS22_RS03250 (MTS22_03250) | 704107..704505 | + | 399 | WP_057078255.1 | phage tail terminator-like protein | - |
| MTS22_RS03255 (MTS22_03255) | 704507..704734 | + | 228 | WP_057078256.1 | hypothetical protein | - |
| MTS22_RS03260 (MTS22_03260) | 704849..705202 | + | 354 | WP_057078257.1 | hypothetical protein | - |
| MTS22_RS03265 (MTS22_03265) | 705202..706557 | + | 1356 | WP_000002416.1 | hypothetical protein | - |
| MTS22_RS03270 (MTS22_03270) | 706610..707527 | + | 918 | WP_000094253.1 | phage tail tube protein | - |
| MTS22_RS03275 (MTS22_03275) | 707598..708113 | + | 516 | WP_024616020.1 | hypothetical protein | - |
| MTS22_RS03280 (MTS22_03280) | 708439..708621 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS22_RS03285 (MTS22_03285) | 708714..709118 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS22_RS03290 (MTS22_03290) | 709218..709742 | + | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| MTS22_RS03295 (MTS22_03295) | 709807..710190 | + | 384 | WP_000725052.1 | hypothetical protein | - |
| MTS22_RS03300 (MTS22_03300) | 710252..710998 | + | 747 | WP_000599537.1 | hypothetical protein | - |
| MTS22_RS03305 (MTS22_03305) | 711084..711575 | + | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| MTS22_RS03310 (MTS22_03310) | 711618..711884 | - | 267 | WP_000774879.1 | hypothetical protein | - |
| MTS22_RS03315 (MTS22_03315) | 712034..712969 | + | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| MTS22_RS03320 (MTS22_03320) | 713310..713825 | + | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 678316..730418 | 52102 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276430 WP_000838146.1 NZ_CP121583:708439-708621 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276430 WP_000966688.1 NZ_CP121583:708714-709118 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|