276426

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3307902..3308581 Replicon chromosome
Accession NZ_CP121577
Organism Acinetobacter baumannii strain RAB55

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag MTS49_RS16165 Protein ID WP_000838146.1
Coordinates 3308399..3308581 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag MTS49_RS16160 Protein ID WP_000966688.1
Coordinates 3307902..3308306 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTS49_RS16125 (MTS49_16125) 3303195..3303710 - 516 WP_001056868.1 Rha family transcriptional regulator -
MTS49_RS16130 (MTS49_16130) 3304051..3304986 - 936 WP_000254125.1 ORF6N domain-containing protein -
MTS49_RS16135 (MTS49_16135) 3305136..3305402 + 267 WP_000774879.1 hypothetical protein -
MTS49_RS16140 (MTS49_16140) 3305445..3305936 - 492 WP_000755583.1 DUF4468 domain-containing protein -
MTS49_RS16145 (MTS49_16145) 3306022..3306768 - 747 WP_000599537.1 hypothetical protein -
MTS49_RS16150 (MTS49_16150) 3306830..3307213 - 384 WP_000725052.1 hypothetical protein -
MTS49_RS16155 (MTS49_16155) 3307278..3307802 - 525 WP_000721574.1 DUF4468 domain-containing protein -
MTS49_RS16160 (MTS49_16160) 3307902..3308306 - 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
MTS49_RS16165 (MTS49_16165) 3308399..3308581 - 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
MTS49_RS16170 (MTS49_16170) 3308907..3309422 - 516 WP_162208568.1 hypothetical protein -
MTS49_RS16175 (MTS49_16175) 3309492..3310409 - 918 WP_000094278.1 phage tail tube protein -
MTS49_RS16180 (MTS49_16180) 3310462..3311640 - 1179 WP_283074921.1 phage tail protein -
MTS49_RS16185 (MTS49_16185) 3311640..3311993 - 354 WP_032051762.1 hypothetical protein -
MTS49_RS16190 (MTS49_16190) 3312089..3312307 - 219 WP_002002228.1 hypothetical protein -
MTS49_RS16195 (MTS49_16195) 3312309..3312707 - 399 WP_002062850.1 phage tail terminator-like protein -
MTS49_RS16200 (MTS49_16200) 3312709..3313077 - 369 WP_001993865.1 hypothetical protein -
MTS49_RS16205 (MTS49_16205) 3313049..3313453 - 405 WP_000247952.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3287213..3340344 53131


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T276426 WP_000838146.1 NZ_CP121577:c3308581-3308399 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT276426 WP_000966688.1 NZ_CP121577:c3308306-3307902 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References