Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3307902..3308581 | Replicon | chromosome |
| Accession | NZ_CP121577 | ||
| Organism | Acinetobacter baumannii strain RAB55 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS49_RS16165 | Protein ID | WP_000838146.1 |
| Coordinates | 3308399..3308581 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS49_RS16160 | Protein ID | WP_000966688.1 |
| Coordinates | 3307902..3308306 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS49_RS16125 (MTS49_16125) | 3303195..3303710 | - | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
| MTS49_RS16130 (MTS49_16130) | 3304051..3304986 | - | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| MTS49_RS16135 (MTS49_16135) | 3305136..3305402 | + | 267 | WP_000774879.1 | hypothetical protein | - |
| MTS49_RS16140 (MTS49_16140) | 3305445..3305936 | - | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| MTS49_RS16145 (MTS49_16145) | 3306022..3306768 | - | 747 | WP_000599537.1 | hypothetical protein | - |
| MTS49_RS16150 (MTS49_16150) | 3306830..3307213 | - | 384 | WP_000725052.1 | hypothetical protein | - |
| MTS49_RS16155 (MTS49_16155) | 3307278..3307802 | - | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| MTS49_RS16160 (MTS49_16160) | 3307902..3308306 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS49_RS16165 (MTS49_16165) | 3308399..3308581 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS49_RS16170 (MTS49_16170) | 3308907..3309422 | - | 516 | WP_162208568.1 | hypothetical protein | - |
| MTS49_RS16175 (MTS49_16175) | 3309492..3310409 | - | 918 | WP_000094278.1 | phage tail tube protein | - |
| MTS49_RS16180 (MTS49_16180) | 3310462..3311640 | - | 1179 | WP_283074921.1 | phage tail protein | - |
| MTS49_RS16185 (MTS49_16185) | 3311640..3311993 | - | 354 | WP_032051762.1 | hypothetical protein | - |
| MTS49_RS16190 (MTS49_16190) | 3312089..3312307 | - | 219 | WP_002002228.1 | hypothetical protein | - |
| MTS49_RS16195 (MTS49_16195) | 3312309..3312707 | - | 399 | WP_002062850.1 | phage tail terminator-like protein | - |
| MTS49_RS16200 (MTS49_16200) | 3312709..3313077 | - | 369 | WP_001993865.1 | hypothetical protein | - |
| MTS49_RS16205 (MTS49_16205) | 3313049..3313453 | - | 405 | WP_000247952.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3287213..3340344 | 53131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276426 WP_000838146.1 NZ_CP121577:c3308581-3308399 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276426 WP_000966688.1 NZ_CP121577:c3308306-3307902 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|