Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 74486..75139 | Replicon | chromosome |
Accession | NZ_CP121577 | ||
Organism | Acinetobacter baumannii strain RAB55 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | MTS49_RS00375 | Protein ID | WP_000607077.1 |
Coordinates | 74486..74875 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | MTS49_RS00380 | Protein ID | WP_001288210.1 |
Coordinates | 74882..75139 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS49_RS00360 (MTS49_00360) | 69604..71799 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
MTS49_RS00365 (MTS49_00365) | 71987..72553 | - | 567 | WP_000651538.1 | rhombosortase | - |
MTS49_RS00370 (MTS49_00370) | 72631..73716 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
MTS49_RS00375 (MTS49_00375) | 74486..74875 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
MTS49_RS00380 (MTS49_00380) | 74882..75139 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
MTS49_RS00385 (MTS49_00385) | 75327..76499 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
MTS49_RS00390 (MTS49_00390) | 76548..78038 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
MTS49_RS00395 (MTS49_00395) | 78220..78597 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
MTS49_RS00400 (MTS49_00400) | 78616..79623 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276425 WP_000607077.1 NZ_CP121577:c74875-74486 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|