Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 10300..10888 | Replicon | plasmid pII_RAB73 |
| Accession | NZ_CP121569 | ||
| Organism | Acinetobacter baumannii strain RAB73 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
| Locus tag | MTS81_RS19425 | Protein ID | WP_000438826.1 |
| Coordinates | 10601..10888 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | MTS81_RS19420 | Protein ID | WP_001983304.1 |
| Coordinates | 10300..10614 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS81_RS19400 (MTS81_19400) | 6128..6499 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS81_RS19405 (MTS81_19405) | 6499..6672 | + | 174 | WP_001282484.1 | hypothetical protein | - |
| MTS81_RS19410 (MTS81_19410) | 6995..7456 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| MTS81_RS19415 (MTS81_19415) | 7761..10172 | - | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
| MTS81_RS19420 (MTS81_19420) | 10300..10614 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| MTS81_RS19425 (MTS81_19425) | 10601..10888 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
| MTS81_RS19430 (MTS81_19430) | 11261..11779 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
| MTS81_RS19435 (MTS81_19435) | 11968..12111 | - | 144 | WP_001125246.1 | hypothetical protein | - |
| MTS81_RS19440 (MTS81_19440) | 12131..12706 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
| MTS81_RS19445 (MTS81_19445) | 12699..13649 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
| MTS81_RS19450 (MTS81_19450) | 14837..15208 | + | 372 | WP_000504218.1 | hypothetical protein | - |
| MTS81_RS19455 (MTS81_19455) | 15208..15381 | + | 174 | WP_001282484.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..17436 | 17436 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276424 WP_000438826.1 NZ_CP121569:c10888-10601 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |