Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 1569..2157 | Replicon | plasmid pII_RAB73 |
Accession | NZ_CP121569 | ||
Organism | Acinetobacter baumannii strain RAB73 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
Locus tag | MTS81_RS19375 | Protein ID | WP_000438826.1 |
Coordinates | 1870..2157 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | MTS81_RS19370 | Protein ID | WP_001983304.1 |
Coordinates | 1569..1883 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS81_RS19370 (MTS81_19370) | 1569..1883 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
MTS81_RS19375 (MTS81_19375) | 1870..2157 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
MTS81_RS19380 (MTS81_19380) | 2530..3048 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
MTS81_RS19385 (MTS81_19385) | 3237..3380 | - | 144 | WP_001125246.1 | hypothetical protein | - |
MTS81_RS19390 (MTS81_19390) | 3400..3975 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
MTS81_RS19395 (MTS81_19395) | 3968..4918 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
MTS81_RS19400 (MTS81_19400) | 6128..6499 | + | 372 | WP_000504218.1 | hypothetical protein | - |
MTS81_RS19405 (MTS81_19405) | 6499..6672 | + | 174 | WP_001282484.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..17436 | 17436 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T276423 WP_000438826.1 NZ_CP121569:c2157-1870 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |