Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 79300..79953 | Replicon | chromosome |
| Accession | NZ_CP121567 | ||
| Organism | Acinetobacter baumannii strain RAB73 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | MTS81_RS00410 | Protein ID | WP_000607077.1 |
| Coordinates | 79300..79689 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | MTS81_RS00415 | Protein ID | WP_001288210.1 |
| Coordinates | 79696..79953 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS81_RS00395 (MTS81_00395) | 74418..76613 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
| MTS81_RS00400 (MTS81_00400) | 76801..77367 | - | 567 | WP_000651538.1 | rhombosortase | - |
| MTS81_RS00405 (MTS81_00405) | 77445..78530 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| MTS81_RS00410 (MTS81_00410) | 79300..79689 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
| MTS81_RS00415 (MTS81_00415) | 79696..79953 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| MTS81_RS00420 (MTS81_00420) | 80141..81313 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| MTS81_RS00425 (MTS81_00425) | 81362..82852 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| MTS81_RS00430 (MTS81_00430) | 83034..83411 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| MTS81_RS00435 (MTS81_00435) | 83430..84437 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276421 WP_000607077.1 NZ_CP121567:c79689-79300 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|