Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3300947..3301626 | Replicon | chromosome |
| Accession | NZ_CP121563 | ||
| Organism | Acinetobacter baumannii strain RAB94 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | MTS31_RS15915 | Protein ID | WP_000838146.1 |
| Coordinates | 3301444..3301626 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | MTS31_RS15910 | Protein ID | WP_000966688.1 |
| Coordinates | 3300947..3301351 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS31_RS15875 (MTS31_15875) | 3296240..3296755 | - | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
| MTS31_RS15880 (MTS31_15880) | 3297096..3298031 | - | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| MTS31_RS15885 (MTS31_15885) | 3298181..3298447 | + | 267 | WP_000774879.1 | hypothetical protein | - |
| MTS31_RS15890 (MTS31_15890) | 3298490..3298981 | - | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| MTS31_RS15895 (MTS31_15895) | 3299067..3299813 | - | 747 | WP_000599537.1 | hypothetical protein | - |
| MTS31_RS15900 (MTS31_15900) | 3299875..3300258 | - | 384 | WP_000725052.1 | hypothetical protein | - |
| MTS31_RS15905 (MTS31_15905) | 3300323..3300847 | - | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| MTS31_RS15910 (MTS31_15910) | 3300947..3301351 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MTS31_RS15915 (MTS31_15915) | 3301444..3301626 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MTS31_RS15920 (MTS31_15920) | 3301952..3302467 | - | 516 | WP_024616020.1 | hypothetical protein | - |
| MTS31_RS15925 (MTS31_15925) | 3302538..3303455 | - | 918 | WP_283026454.1 | phage tail tube protein | - |
| MTS31_RS15930 (MTS31_15930) | 3303508..3304812 | - | 1305 | WP_283026455.1 | pyocin knob domain-containing protein | - |
| MTS31_RS15935 (MTS31_15935) | 3304812..3305165 | - | 354 | WP_283026456.1 | hypothetical protein | - |
| MTS31_RS15940 (MTS31_15940) | 3305261..3305479 | - | 219 | WP_031380852.1 | hypothetical protein | - |
| MTS31_RS15945 (MTS31_15945) | 3305481..3305879 | - | 399 | WP_001251837.1 | phage tail terminator-like protein | - |
| MTS31_RS15950 (MTS31_15950) | 3305881..3306249 | - | 369 | WP_031380853.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3283271..3334952 | 51681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276419 WP_000838146.1 NZ_CP121563:c3301626-3301444 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276419 WP_000966688.1 NZ_CP121563:c3301351-3300947 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|