Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 79307..79960 | Replicon | chromosome |
Accession | NZ_CP121563 | ||
Organism | Acinetobacter baumannii strain RAB94 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | MTS31_RS00410 | Protein ID | WP_000607077.1 |
Coordinates | 79307..79696 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | MTS31_RS00415 | Protein ID | WP_001288210.1 |
Coordinates | 79703..79960 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS31_RS00395 (MTS31_00395) | 74425..76620 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
MTS31_RS00400 (MTS31_00400) | 76808..77374 | - | 567 | WP_000651538.1 | rhombosortase | - |
MTS31_RS00405 (MTS31_00405) | 77452..78537 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
MTS31_RS00410 (MTS31_00410) | 79307..79696 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
MTS31_RS00415 (MTS31_00415) | 79703..79960 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
MTS31_RS00420 (MTS31_00420) | 80148..81320 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
MTS31_RS00425 (MTS31_00425) | 81369..82859 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
MTS31_RS00430 (MTS31_00430) | 83041..83418 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
MTS31_RS00435 (MTS31_00435) | 83437..84444 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276418 WP_000607077.1 NZ_CP121563:c79696-79307 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|