Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3933850..3934503 | Replicon | chromosome |
| Accession | NZ_CP121560 | ||
| Organism | Acinetobacter baumannii strain RAB97 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | MTS88_RS19275 | Protein ID | WP_000607077.1 |
| Coordinates | 3934114..3934503 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | MTS88_RS19270 | Protein ID | WP_001288210.1 |
| Coordinates | 3933850..3934107 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTS88_RS19250 (MTS88_19250) | 3929366..3930373 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| MTS88_RS19255 (MTS88_19255) | 3930392..3930769 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| MTS88_RS19260 (MTS88_19260) | 3930951..3932441 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| MTS88_RS19265 (MTS88_19265) | 3932490..3933662 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| MTS88_RS19270 (MTS88_19270) | 3933850..3934107 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| MTS88_RS19275 (MTS88_19275) | 3934114..3934503 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
| MTS88_RS19280 (MTS88_19280) | 3935273..3936358 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| MTS88_RS19285 (MTS88_19285) | 3936436..3937002 | + | 567 | WP_000651538.1 | rhombosortase | - |
| MTS88_RS19290 (MTS88_19290) | 3937190..3939385 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276415 WP_000607077.1 NZ_CP121560:3934114-3934503 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|