Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 1020510..1021163 | Replicon | chromosome |
Accession | NZ_CP121557 | ||
Organism | Acinetobacter baumannii strain RAB9 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | MTS96_RS04700 | Protein ID | WP_000607077.1 |
Coordinates | 1020510..1020899 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | MTS96_RS04705 | Protein ID | WP_001288210.1 |
Coordinates | 1020906..1021163 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTS96_RS04685 (MTS96_04685) | 1015628..1017823 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
MTS96_RS04690 (MTS96_04690) | 1018011..1018577 | - | 567 | WP_000651538.1 | rhombosortase | - |
MTS96_RS04695 (MTS96_04695) | 1018655..1019740 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
MTS96_RS04700 (MTS96_04700) | 1020510..1020899 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
MTS96_RS04705 (MTS96_04705) | 1020906..1021163 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
MTS96_RS04710 (MTS96_04710) | 1021351..1022523 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
MTS96_RS04715 (MTS96_04715) | 1022572..1024062 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
MTS96_RS04720 (MTS96_04720) | 1024244..1024621 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
MTS96_RS04725 (MTS96_04725) | 1024640..1025647 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T276412 WP_000607077.1 NZ_CP121557:c1020899-1020510 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|