Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2113546..2114016 Replicon chromosome
Accession NZ_CP121529
Organism Staphylococcus epidermidis strain 1FSE03

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA592_RS09910 Protein ID WP_001829569.1
Coordinates 2113828..2114016 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA592_RS09905 Protein ID WP_002438963.1
Coordinates 2113546..2113803 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA592_RS09870 2108833..2108988 - 156 WP_001829648.1 hypothetical protein -
QA592_RS09875 2109000..2109187 - 188 Protein_1908 hypothetical protein -
QA592_RS09880 2109338..2110537 - 1200 WP_071813262.1 IS110-like element ISSep2 family transposase -
QA592_RS09885 2111134..2111634 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA592_RS09890 2111905..2112492 - 588 WP_002469329.1 histidine phosphatase family protein -
QA592_RS09895 2112706..2112942 + 237 WP_002457224.1 hypothetical protein -
QA592_RS09900 2112934..2113137 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA592_RS09905 2113546..2113803 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA592_RS09910 2113828..2114016 + 189 WP_001829569.1 hypothetical protein Toxin
QA592_RS09915 2114206..2114760 + 555 WP_002469327.1 lipoprotein N-acylation protein LnsA -
QA592_RS09920 2114820..2115053 - 234 WP_001829664.1 hypothetical protein -
QA592_RS09925 2115337..2116083 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA592_RS09930 2116182..2116466 + 285 WP_002488882.1 hypothetical protein -
QA592_RS09935 2116490..2116714 + 225 WP_001829613.1 hypothetical protein -
QA592_RS09940 2117335..2117535 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276411 WP_001829569.1 NZ_CP121529:2113828-2114016 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276411 WP_002438963.1 NZ_CP121529:2113546-2113803 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References