Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1251251..1251721 Replicon chromosome
Accession NZ_CP121527
Organism Staphylococcus epidermidis strain 1FSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA586_RS06150 Protein ID WP_001829569.1
Coordinates 1251533..1251721 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA586_RS06145 Protein ID WP_002438963.1
Coordinates 1251251..1251508 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA586_RS06110 1246536..1246673 - 138 WP_162161215.1 hypothetical protein -
QA586_RS06115 1246703..1246890 - 188 Protein_1164 hypothetical protein -
QA586_RS06120 1247041..1248240 - 1200 WP_278269209.1 IS110-like element ISSep2 family transposase -
QA586_RS06125 1248837..1249337 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA586_RS06130 1249608..1250195 - 588 WP_002469329.1 histidine phosphatase family protein -
QA586_RS06135 1250409..1250645 + 237 WP_002457224.1 hypothetical protein -
QA586_RS06140 1250637..1250852 - 216 WP_278276480.1 sterile alpha motif-like domain-containing protein -
QA586_RS06145 1251251..1251508 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA586_RS06150 1251533..1251721 + 189 WP_001829569.1 hypothetical protein Toxin
QA586_RS06155 1251911..1252465 + 555 WP_002469327.1 lipoprotein N-acylation protein LnsA -
QA586_RS06160 1252525..1252758 - 234 WP_001829664.1 hypothetical protein -
QA586_RS06165 1253042..1253788 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA586_RS06170 1253887..1254171 + 285 WP_001829635.1 hypothetical protein -
QA586_RS06175 1254195..1254419 + 225 WP_001829613.1 hypothetical protein -
QA586_RS06180 1255040..1255240 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276407 WP_001829569.1 NZ_CP121527:1251533-1251721 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276407 WP_002438963.1 NZ_CP121527:1251251-1251508 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References