Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 249318..250120 | Replicon | chromosome |
Accession | NZ_CP121527 | ||
Organism | Staphylococcus epidermidis strain 1FSE01 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | QA586_RS01400 | Protein ID | WP_002468490.1 |
Coordinates | 249941..250120 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | QA586_RS01395 | Protein ID | WP_002486232.1 |
Coordinates | 249318..249917 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA586_RS01370 | 244530..245987 | + | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
QA586_RS01375 | 245980..246702 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
QA586_RS01380 | 247217..247348 | + | 132 | WP_255264851.1 | hypothetical protein | - |
QA586_RS01385 | 247563..248693 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QA586_RS01390 | 248690..249160 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QA586_RS01395 | 249318..249917 | + | 600 | WP_002486232.1 | glucosamine-6-phosphate isomerase | Antitoxin |
QA586_RS01400 | 249941..250120 | + | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
QA586_RS01405 | 250276..250680 | + | 405 | WP_002485605.1 | hypothetical protein | - |
QA586_RS01410 | 250865..252250 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
QA586_RS01415 | 252611..253435 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
QA586_RS01420 | 253594..254727 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T276406 WP_002468490.1 NZ_CP121527:249941-250120 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22695.55 Da Isoelectric Point: 4.8641
>AT276406 WP_002486232.1 NZ_CP121527:249318-249917 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGNLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGNLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|