Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 80440..80969 | Replicon | chromosome |
Accession | NZ_CP121527 | ||
Organism | Staphylococcus epidermidis strain 1FSE01 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | QA586_RS00440 | Protein ID | WP_001829891.1 |
Coordinates | 80607..80969 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | QA586_RS00435 | Protein ID | WP_001829931.1 |
Coordinates | 80440..80610 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA586_RS00410 | 76264..76743 | + | 480 | WP_002457111.1 | PH domain-containing protein | - |
QA586_RS00415 | 76736..78241 | + | 1506 | WP_002457110.1 | PH domain-containing protein | - |
QA586_RS00420 | 78228..78737 | + | 510 | WP_002457109.1 | PH domain-containing protein | - |
QA586_RS00425 | 78785..79138 | + | 354 | WP_002457108.1 | holo-ACP synthase | - |
QA586_RS00430 | 79205..80353 | + | 1149 | WP_002457107.1 | alanine racemase | - |
QA586_RS00435 | 80440..80610 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QA586_RS00440 | 80607..80969 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QA586_RS00445 | 81314..82315 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
QA586_RS00450 | 82415..82741 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
QA586_RS00455 | 82743..83222 | + | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
QA586_RS00460 | 83197..83967 | + | 771 | WP_002440602.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T276405 WP_001829891.1 NZ_CP121527:80607-80969 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |