Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1335022..1335824 | Replicon | chromosome |
Accession | NZ_CP121526 | ||
Organism | Staphylococcus epidermidis strain 1FSE05 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | QA624_RS07855 | Protein ID | WP_002468490.1 |
Coordinates | 1335022..1335201 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | Q5HN82 |
Locus tag | QA624_RS07860 | Protein ID | WP_002456349.1 |
Coordinates | 1335225..1335824 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA624_RS07835 | 1330415..1331548 | - | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
QA624_RS07840 | 1331707..1332531 | + | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
QA624_RS07845 | 1332892..1334277 | - | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
QA624_RS07850 | 1334462..1334866 | - | 405 | WP_001829818.1 | hypothetical protein | - |
QA624_RS07855 | 1335022..1335201 | - | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
QA624_RS07860 | 1335225..1335824 | - | 600 | WP_002456349.1 | glucosamine-6-phosphate isomerase | Antitoxin |
QA624_RS07865 | 1335982..1336452 | - | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QA624_RS07870 | 1336449..1337579 | - | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QA624_RS07875 | 1337789..1337944 | - | 156 | WP_001829854.1 | hypothetical protein | - |
QA624_RS07880 | 1338324..1339523 | - | 1200 | WP_071813246.1 | IS110-like element ISSep2 family transposase | - |
QA624_RS07885 | 1340001..1340723 | - | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T276401 WP_002468490.1 NZ_CP121526:c1335201-1335022 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22709.62 Da Isoelectric Point: 4.9942
>AT276401 WP_002456349.1 NZ_CP121526:c1335824-1335225 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HY44 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E9LUD0 |