Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 369783..370253 Replicon chromosome
Accession NZ_CP121526
Organism Staphylococcus epidermidis strain 1FSE05

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA624_RS03400 Protein ID WP_001829569.1
Coordinates 369783..369971 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA624_RS03405 Protein ID WP_002438963.1
Coordinates 369996..370253 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA624_RS03370 366264..366464 + 201 WP_001829681.1 cold-shock protein -
QA624_RS03375 367085..367309 - 225 WP_001829613.1 hypothetical protein -
QA624_RS03380 367333..367617 - 285 WP_002488882.1 hypothetical protein -
QA624_RS03385 367716..368462 - 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA624_RS03390 368746..368979 + 234 WP_001829664.1 hypothetical protein -
QA624_RS03395 369039..369593 - 555 WP_002469327.1 lipoprotein N-acylation protein LnsA -
QA624_RS03400 369783..369971 - 189 WP_001829569.1 hypothetical protein Toxin
QA624_RS03405 369996..370253 - 258 WP_002438963.1 hypothetical protein Antitoxin
QA624_RS03410 370662..370865 + 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA624_RS03415 370857..371093 - 237 WP_002457224.1 hypothetical protein -
QA624_RS03420 371307..371894 + 588 WP_002469329.1 histidine phosphatase family protein -
QA624_RS03425 372165..372665 - 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA624_RS03430 373262..374461 + 1200 WP_071813262.1 IS110-like element ISSep2 family transposase -
QA624_RS03435 374612..374799 + 188 Protein_344 hypothetical protein -
QA624_RS03440 374811..374966 + 156 WP_001829648.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 366264..380841 14577


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276400 WP_001829569.1 NZ_CP121526:c369971-369783 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276400 WP_002438963.1 NZ_CP121526:c370253-369996 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References