Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2105594..2106064 Replicon chromosome
Accession NZ_CP121522
Organism Staphylococcus epidermidis strain 1DSE05

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA593_RS09955 Protein ID WP_001829569.1
Coordinates 2105876..2106064 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA593_RS09950 Protein ID WP_002438963.1
Coordinates 2105594..2105851 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA593_RS09910 2100960..2101676 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
QA593_RS09915 2101837..2102259 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA593_RS09920 2102443..2102598 - 156 WP_001829648.1 hypothetical protein -
QA593_RS09925 2102610..2102797 - 188 Protein_1919 hypothetical protein -
QA593_RS09930 2103184..2103684 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA593_RS09935 2103955..2104542 - 588 WP_001829615.1 histidine phosphatase family protein -
QA593_RS09940 2104754..2104990 + 237 WP_002457224.1 hypothetical protein -
QA593_RS09945 2104982..2105185 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA593_RS09950 2105594..2105851 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA593_RS09955 2105876..2106064 + 189 WP_001829569.1 hypothetical protein Toxin
QA593_RS09960 2106254..2106807 + 554 Protein_1926 hypothetical protein -
QA593_RS09965 2106867..2107100 - 234 WP_001829664.1 hypothetical protein -
QA593_RS09970 2107384..2108130 + 747 WP_002495246.1 poly-gamma-glutamate hydrolase family protein -
QA593_RS09975 2108229..2108513 + 285 WP_001829635.1 hypothetical protein -
QA593_RS09980 2108537..2108761 + 225 WP_001829613.1 hypothetical protein -
QA593_RS09985 2109382..2109582 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2096631..2137150 40519
- flank IS/Tn - - 2102443..2102598 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276399 WP_001829569.1 NZ_CP121522:2105876-2106064 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276399 WP_002438963.1 NZ_CP121522:2105594-2105851 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References