Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1400792..1401262 Replicon chromosome
Accession NZ_CP121518
Organism Staphylococcus epidermidis strain 6DSE07

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA594_RS06755 Protein ID WP_001829569.1
Coordinates 1400792..1400980 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA594_RS06760 Protein ID WP_002438963.1
Coordinates 1401005..1401262 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA594_RS06725 1397273..1397473 + 201 WP_001829681.1 cold-shock protein -
QA594_RS06730 1398094..1398318 - 225 WP_001829613.1 hypothetical protein -
QA594_RS06735 1398342..1398626 - 285 WP_001829635.1 hypothetical protein -
QA594_RS06740 1398725..1399471 - 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA594_RS06745 1399755..1399988 + 234 WP_001829664.1 hypothetical protein -
QA594_RS06750 1400048..1400602 - 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
QA594_RS06755 1400792..1400980 - 189 WP_001829569.1 hypothetical protein Toxin
QA594_RS06760 1401005..1401262 - 258 WP_002438963.1 hypothetical protein Antitoxin
QA594_RS06765 1401671..1401874 + 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA594_RS06770 1401866..1402102 - 237 WP_002457224.1 hypothetical protein -
QA594_RS06775 1402316..1402903 + 588 WP_001829615.1 histidine phosphatase family protein -
QA594_RS06780 1403174..1403674 - 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA594_RS06785 1404061..1404248 + 188 Protein_1319 hypothetical protein -
QA594_RS06790 1404278..1404415 + 138 WP_162161215.1 hypothetical protein -
QA594_RS06795 1404599..1405021 - 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA594_RS06800 1405182..1405898 + 717 WP_278276779.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1397273..1404415 7142
- flank IS/Tn - - 1404260..1404415 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276394 WP_001829569.1 NZ_CP121518:c1400980-1400792 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276394 WP_002438963.1 NZ_CP121518:c1401262-1401005 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References