Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 11895..12424 | Replicon | chromosome |
| Accession | NZ_CP121518 | ||
| Organism | Staphylococcus epidermidis strain 6DSE07 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q5HME7 |
| Locus tag | QA594_RS00060 | Protein ID | WP_001829891.1 |
| Coordinates | 11895..12257 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q5HME6 |
| Locus tag | QA594_RS00065 | Protein ID | WP_001829931.1 |
| Coordinates | 12254..12424 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA594_RS00040 | 8897..9667 | - | 771 | WP_002440602.1 | RNA polymerase sigma factor SigB | - |
| QA594_RS00045 | 9642..10121 | - | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
| QA594_RS00050 | 10123..10449 | - | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
| QA594_RS00055 | 10549..11550 | - | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
| QA594_RS00060 | 11895..12257 | - | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QA594_RS00065 | 12254..12424 | - | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QA594_RS00070 | 12511..13659 | - | 1149 | WP_002457107.1 | alanine racemase | - |
| QA594_RS00075 | 13726..14079 | - | 354 | WP_002457108.1 | holo-ACP synthase | - |
| QA594_RS00080 | 14127..14636 | - | 510 | WP_002457109.1 | PH domain-containing protein | - |
| QA594_RS00085 | 14623..16128 | - | 1506 | WP_002457110.1 | PH domain-containing protein | - |
| QA594_RS00090 | 16121..16600 | - | 480 | WP_010959254.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T276392 WP_001829891.1 NZ_CP121518:c12257-11895 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G7HWR0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0N1EF65 |